SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00007706 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00007706
Domain Number 1 Region: 29-211
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-31
Family RUN domain 0.0036
Further Details:      
 
Domain Number 2 Region: 404-496
Classification Level Classification E-value
Superfamily PX domain 1.83e-21
Family PX domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00007706
Sequence length 520
Sequence
MPENAASSVPTEAGFRNLRCQLSGSTFGQRREDIFRRVQESAHQISLKYNGKELATERDE
SVQELCDSFEELLSYGLRQSASGSSFSAANIIQNMQEIVSGNAIGGSNNNDATFWEFCQS
HLTPHERQRYMDLKQIWTNVGRGRAFIRSTLNERRLHSHVLTWLSDEEQLHRYYTPWSLL
LNDEVAKKLPEILDSLRDVLFALNVDTTELNAPRRLAAIVKEEPIIIAPSPVPVIGRHKN
RPGIAVERPIEGATSTEDLLSALTPIQSVEVQQLLSNDAIEQELATSVDEVTVGPFDPIG
PELEFLKTPLPEIFPQAAPEPDLYEDRSDTSSQWSKSSSSANCVANSQQQAALEEQVNQL
NERCALLETRVAELNLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPQVKLAKTQRTG
SHYTYEVHITMRQRLEHWTFFRRYSEFNKLHKTLLKTHPVVSAVEFPPKKHFGNMNLVFV
EERRQQLQIYLLNLVEVLPQVEACKSKAELQKVFPFFRER
Download sequence
Identical sequences XP_016932669.1.48971 DS10_00007706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]