SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00008148 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00008148
Domain Number 1 Region: 397-548
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.32e-36
Family CRAL/TRIO domain 0.0012
Further Details:      
 
Domain Number 2 Region: 87-215
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.28e-29
Family CRAL/TRIO domain 0.0018
Further Details:      
 
Domain Number 3 Region: 235-342
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.62e-22
Family CRAL/TRIO domain 0.0039
Further Details:      
 
Domain Number 4 Region: 16-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000109
Family CRAL/TRIO N-terminal domain 0.011
Further Details:      
 
Domain Number 5 Region: 351-393
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000327
Family CRAL/TRIO N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00008148
Sequence length 551
Sequence
MPSDQEPTAEQISQVKTSILEKLEKEPPAVPFHPTDLKRITDSDLWISKLLEAYDLDVEK
CITRLWDNLAWRQSFGVYDLGESNLNQEYLNDGSVYVHNKDKDGNPLLILTINKHSKSRK
QEDLLRILVFWIERLQSDSKVEKVTLFMDMTGSGLSNLDLDFIKSIIGVFETKYPYILNY
ILVHELPFLLNAAFKIVKTFLPEKALKILKVTSKKDIVHRLPTIAAIYSESNLNQEYLND
GSVYVHNKDKDGNPLLILTINKHSKSRKQEDLLRILVFWIERLQSDSKVEKVTLFMDMTG
SGLSNLDLDFIKSIIGVFETKYPYILNYILVHELPFLLNVPFHPTDLKRITDSDLWISKL
LEAYDLDVEKCITRLWDNLAWRQSFGVYDLSESNLNQEYLNDGSVYVHNKDKDGNPLLIL
TINKHSKSRKQEDLLRILVFWIERLQSDSKVEKVTLFMDMTGSGLSNLDLDFIKSIIGVF
ETKYPYILNYILVHELPFLLNAAFKIVKTFLPEKALKILKVTSKKDIVQYVDKDNCLKIW
GGNDEYVYKFA
Download sequence
Identical sequences DS10_00008148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]