SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00008149 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00008149
Domain Number 1 Region: 279-418
Classification Level Classification E-value
Superfamily PapD-like 1.07e-30
Family MSP-like 0.0016
Further Details:      
 
Domain Number 2 Region: 88-241
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.46e-30
Family CRAL/TRIO domain 0.0038
Further Details:      
 
Domain Number 3 Region: 7-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000222
Family CRAL/TRIO N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00008149
Sequence length 640
Sequence
MGIKVKETTPQHIEELRERFNSKYASSPPAAPFHPTDLDRIRNDHLWLQRFLEMHDLDME
ASFNKLWETCVWRQSYGANDLEPSQLNQEYLNEGSIFVHSNDVDGKPLLIFRVKLHSKSK
NLDELIRIVVYWVERTQRQQHLTQLTIFFDMAGTGLATMDLDFVRRIVETFKLYYPNTLN
YILVYELAWVLNAAFKVIKALLPPKAVEILKMISKKDIGQYITKDKSLAIWGGEDNYEFS
FVPEAKQVTSKPLAANAGDDEQFADVDKKVTFANTAPLVLKESNINEMHTPSEGMLHINP
KEFVNFNSKNAEATLNLKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEASINIWLKS
EHQLSGESKDKFLVMAMLAPGGECGGSDVAELWRNKSPSAVDVEQHRLVCRFDENKPKAQ
PDCAAKASKASVDCKKSAVGHDPASAMERQLAFTQNLQYVTLALLLLLFAGFGFLMYQQL
GHHASTCPKATAYSQELNDAARKGHNNNDHDCDCPELESCACAFDLMDMGLDCADTMDQF
DGDCLEALIQTHLQLCRSCQGIGDRQLGGVAAGGHLLGLIAFARKLVRVVLSLSLLCGIL
FVSFYLGSNYGGNCTTTTTITTSLATVDSGRGNRQPCYYS
Download sequence
Identical sequences DS10_00008149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]