SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00009991 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00009991
Domain Number 1 Region: 77-141
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000262
Family RUN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00009991
Sequence length 173
Sequence
MKRPTFLGGPIHPWLYIEEAATREVEKDFESVYSRLVLCKTYRLDEDGKVLTPEELLYRC
VQAINQTHDDAHAQMDVKLRSLICLGLNEQVLHLWLEVLCACQEVVQKWYHSWSFIDSPG
WVQIKCELRILSQFAFNLNPDWELPPKRGKESQPLKDGVRDMLVKHHLFSWDL
Download sequence
Identical sequences DS10_00009991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]