SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00000192 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00000192
Domain Number 1 Region: 164-321
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.2e-66
Family DNA-binding protein LAG-1 (CSL) 0.000000844
Further Details:      
 
Domain Number 2 Region: 18-166
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-60
Family DNA-binding protein LAG-1 (CSL) 0.0000106
Further Details:      
 
Domain Number 3 Region: 322-434
Classification Level Classification E-value
Superfamily E set domains 1.36e-39
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00000192
Sequence length 509
Sequence
MQMSLLPGPYRPHIEEKKLTRDAMEKYMRERNDMVIVILHAKVAQKSYGNEKRFFCPPPC
IYLFGSGWRRRYEEMLQQGEGEQGAQLCAFIGIGSSDQDMQQLDLNGKQYCAAKTLFISD
SDKRKHFMLSVKMFYGNGHDIGVFNSKRIKVISKPSKKKQSLKNADLCIASGTNVALFNR
LRSQTVSTRYLHVENGHFHASSTQWGAFTIHLLDDNESESEEFQVRDGYIHYGATVKLVC
SVTGMALPRLIIRKVDKQMALLEADDPVSQLHKCAFYMKDTDRMYLCLSQEKIIQFQATP
CPKEPNKEMINDGACWTIISTDKAEYQFYEGMGPVASPVTPVPIVNSLNLNGGGDVAMLE
LSGDNFTPHLQVWFGDVEAETMYRCTETLLCVVPEISQFRGEWLWVRQPTQVPISLVRND
GIIYATGLTFTYTPEPGPRPHCNTQAEDVMRTRQNNNNNNITSISNNNNSNNAGSPAGGS
MQQQQQPQQHQALPSISEVQWNSHGSGLS
Download sequence
Identical sequences DS10_00000192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]