SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00001638 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00001638
Domain Number 1 Region: 40-275
Classification Level Classification E-value
Superfamily L domain-like 2.79e-37
Family Ngr ectodomain-like 0.004
Further Details:      
 
Domain Number 2 Region: 271-384
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00001638
Sequence length 652
Sequence
MDPCSLSCTHLSLFLLKLYCLVFLLQSASADWLMDCGDCHCKWNSGKKTADCRNLSLSGI
PEYLSPEVQVLDLSHNHIFYLEENAFSTTHLQNLQKLLIRNGTLKRINHKSFTQLQILIE
LDLSNNLLQDLIPSVFDCLSKVRAILLNGNLIQTLRQGVFRNLKYLHKIEMKRNRLVSID
TQAFVGVPLLSQIYLDNNELTKLRVDSFQGLSKLTALSLAENPWNCTCDLQMFRDFVIGM
NLYTPPTACHYPLQLRGRLWIEDQPEAFACKPKIVYPALGTSINTSKENVTLICRVQGSP
NTVIAWDYNNQVYESRSKVVKGLQKQRVYIEMLRENEPKVQNFGHDVFVSRLTIVNARKS
DEGVYTCLAENPGGKDSVHISVVVQKDLQRIPLIDTNFFAIVCLIAMGFLSMSILLSLVT
CLIFKRFKQFHPSQHTYLQPTNFSAQQLEREEGISALSSGVVQGGKIVLDPLSAANGTSC
SNYMLFNGNESNPENSLSKRKPDDVRLNTNSYFGYIDNQTGPTSSRNQGFFSENSGVQNN
EEIKQKDKLDEIPQRFDLKRSSHSNGGLKKNGQYEEHQPDLLPSNESTAFKNQEEPMVRP
SKKEVINPRSRYNTNVQKYLKEKYGSVRTNNKNTNKDISADMVKPPITARPP
Download sequence
Identical sequences XP_016923887.1.48971 XP_016923895.1.48971 DS10_00001638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]