SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00001711 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00001711
Domain Number 1 Region: 575-769
Classification Level Classification E-value
Superfamily Sec7 domain 7.06e-71
Family Sec7 domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 90-109,339-519,980-1428,1543-1635
Classification Level Classification E-value
Superfamily ARM repeat 6.76e-21
Family HspBP1 domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00001711
Sequence length 1653
Sequence
MHNNSTKTKEMFIVRALEKILADKDIRRSHHSQLKKSCDSALEQIKAELISAGQIAEGNE
LPCAALPLPKNDASSIINAETYFLPFELACKSRSPRIVVTALDCLQKLIAYGHLTGSIQD
SANPGHLLIDRIVVTIYGCFNGPQTDEGVQLQIIKALLTVVTSQHVEIHEFTLLQAVRTC
YDIYLSSKNLVNQTTARATLTQMLNVIFARMENQVYELPPPSTNPINGSIHSEDCNGSGE
EPLGDSDEVIASELLAEIISAAYNEAMKDQESVGEPEPTVNGNDYSSHSDHDSVELHSEN
DAVVTAKFTHILQKDAFLVFRALCKLSMKPLPEGHPDPKSHELRSKVLSLHLLLLILQNA
GPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFELSLSIFVALLSNFKVHLKRQIEVFF
KEIFLNILEANSSSFEHKWMVIQALTRICADAQSVVDIYVNYDCDFSAANLFERLVNDLS
KIAQGRQALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPALQVQSPT
TTDHDQADTTIQTMHSGSSHSLNSNQELLQDLPEALEERKMRKEVMETGIELFNRKPQKG
VQFLQEKQLLGATCQDIARWLHEDERLDKTVIGNYLGENDDHSKEVMCAYIDAFDFRQLE
VVAALRILLEEFRLPGEAQKIDRLMEKFASRYCECNPQNQLFQSADTVYVLAFSIIMLTT
DLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSGMLQQPK
PTGKQPFITEKRRKLLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKMAWT
PFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAYVQALARFTLLNANSP
INEMKAKNIDTIKTLIMVAHTDGNYLGSSWLDIVKCISQLELAQLIGTGVRPQFLSGAQT
TLKDSLNPSVKEHIGETSSQSVVVAVDRIFTGSMRLDGDAIVDFVKALCQVSVDELQQQQ
PRMFSLQKIVEISYYNMERIRLQWSRIWQVLGEHFNAVGCNSNEEISFFALDSLRQLSMK
FMEKGEFSNFRFQKDFLRPFEHIMKKNASPAIRDMVVRCIAQMVNSQAHNIRSGWKNIFS
IFHLAAGDHEEPIVELAFTTTGKIIGDLYQRQFAIMVDSFQDAVKCLSEFATARFPDTSM
EAIRLVRTCAQCVHEAPQLFAEHAGMENDASVAEEDRVWVRGWFPMLFSLSCVVNRCKLD
VRTRALTVLFEIVKTYGESFKPNWWKDLFNVIFRIFDNMKLPEHVTEKSEWMTTTCNHAL
YAIIDVFTQYFDVLGHLLLEELFAQLHWCVQQSNEQLARSGTNCLENLVISNGFKFNEST
WDKTCQCILDIFNATLPQDLLSWRPKAHSSNNLPQEHNHFEALHIRCVVQLELIQTMDNI
VFFPATSRKEDAETLAQAAADLTGGRNGSQSQLLECQREEQGMYGYLRTRQLLTLADCLM
QSHRFAKRFNADHDQRSLLWRAGFKGSVKPNLLKQETSSLACVLRIFFKMYGDENRRSDW
PGIEQELVQVCKEALGYYLSLQSEAHRDAWTSLLLLILTRLLKMSDARFATHVSNYYSLL
CDMMCFDLKPELRSVLRRVFMRIGPVFNIMSVK
Download sequence
Identical sequences XP_016943636.1.48971 DS10_00001711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]