SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00001945 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00001945
Domain Number 1 Region: 28-259
Classification Level Classification E-value
Superfamily L domain-like 2.18e-41
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 258-367
Classification Level Classification E-value
Superfamily Immunoglobulin 9.82e-16
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00001945
Sequence length 896
Sequence
MRALPILVSLLTLLAPSLACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFS
GNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSE
TFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLR
LDGNRIGFIQGPHILPKSLHGISLHSNRWNCDCRLLDIHSWLVNYNTPLAEEPKCMEPAR
LKGQVIKGLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSN
DSLVDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLR
VIIKEPPVVNEVSFPRDYMNYIVASSAGGGIIFVVLLCTIVVKCKKSSEPAKQRKKCDQV
TSIAGGTDSSTGSTQDTGMGMMKCASILNDGGDSMNGNAGLLMGDTMTPTKAANGAAGGG
IILGNQMKQNLLLYASPNPGQQQQQLQLNVNLMGAGPGSPPLLLSNGHGLAAAYCSPPAS
LRNYQEKNPDLVNDAESVKHKLKTAVSLDGAGEYETQSDCGQYEGCYQLAAAPHPHQHPG
HQHPHPGHPLMGRFAQAMTTLPRGMQLKPAPHQVDVHLNPVCFLGQDGSFAYDYSSAHLV
QQPPQQQQQQVQPAANFYRTLPHNRLHKQQQFQAAAAAGGNVGGGNPTLRYSLEAEFIQR
GPTVSYEKYQLPNVRFTAEGYPQQQQQQQQQQQQQQQQQQQLQLQHQFPSPPEGYKSDLA
VMPAPFQQWPSCLPGYRFAQSPTSQPAVATPPAAVVAAPGPPSSSAGTTQSTIPELDESE
ACSPRLEEAAAAGSAAPPGGGEEENSDSAKLKQLNGPLADSPDEGYVGDGQETSDI
Download sequence
Identical sequences XP_016944906.1.48971 DS10_00001945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]