SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00003218 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00003218
Domain Number 1 Region: 56-522
Classification Level Classification E-value
Superfamily Sema domain 2.75e-138
Family Sema domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 576-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000548
Family I set domains 0.062
Further Details:      
 
Domain Number 3 Region: 528-554
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000319
Family Plexin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00003218
Sequence length 724
Sequence
MPLLQLSPLIALLLLLSCSVSETAADYENTWNFYYERPCCTGSDQGNNNYGKHGADHVRE
FNCGKLYYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLEPTRDDVVSCVS
KGKSQIFDCKNHVRVIQSMEQGDRLYVCGTNAHNPKDYVIYANLTHLPRSEYVIGVGLGI
AKCPYDPLDNSTAIYVEDGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFK
RTLKYDSKWLDKPNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGKNL
LAHNWATYLKARLNCSISGEFPFYFNEIQSVYQLPSDKSRFFATFTTSTNGLIGSAVCSF
HINEIQAAFNGKFKEQSSSNSAWLPVLNSRVPEPRPGTCVNDTSNLPDTVLNFIRSHPLM
DKAVNHEHNNPVYYKRDLVFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYYRNGE
SLSKLLDIFEVAPNEAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRCVRDPY
CGWDKEANTCRPYELDLLQDVANETSDICDSSVLKKKIVVTYGQSVHLGCFVKIPEVLKN
EQVTWYHHSKDKGRYEIRYSPTKYIETTERGLVVVSVNEADGGRYDCHLGGSLLCSYNIT
VDAHRCTPPNKSNDYQKIYSDWCHEFEKYKTAMKSWEKKQAQCSTRQNFSSNQHPNEIFR
KPNV
Download sequence
Identical sequences DS10_00003218 XP_016930130.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]