SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00003518 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00003518
Domain Number 1 Region: 19-189
Classification Level Classification E-value
Superfamily RUN domain-like 2.48e-32
Family RUN domain 0.0022
Further Details:      
 
Weak hits

Sequence:  DS10_00003518
Domain Number - Region: 649-698
Classification Level Classification E-value
Superfamily RING/U-box 0.0777
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00003518
Sequence length 718
Sequence
MSSLFRSLNHFSSKRENVVKEALINTLNENAREIEFEVKQKSLEVLGLCEQTSALCTTLE
ALFLHGLKDSFLSATFNVIAGDVERRPDPSFWSPCMVFMHKQVIEQIQGLSQITSEIGQC
RAWVRQSLNESVFSSYLNNMRKNGSALSQYYKRNALIRDSDGLETAAKIMESLEAYVQFD
LPVNSSLLNQWPDYSLQLSDLWTPALKSCPISSGVDVASSLGSDIITIPTPQPLQTNELF
SESISNSPFSRNSNFGVPDLSQRENLDLLLQKIDEMDVINEELTGGEAADASEAVDPDVP
SGSKPKARKKSNHVDKSFTELDLEAPCLLPQGSNSLSNLMQTSWSGDLEATPTSPSEELT
GSRFFQRSVSISSAASLRSPNTDRCSYNALLRKHESNRESGAGWSEIWEKFRASASNLNV
AQPPRDSDPPISEDLSDLQSLDTNSEFELLTSEFDMVELQQMVAQLCQLAREPGLNAQGF
LCKSCQHPLGIGYSNFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSVSKRAATF
LAEFRSHPFLDMQLLNPRIYFASDAMAELQSLRIRLNFIRAYLYTCAPSSIELLQNQFAG
REYLYEHIHLYSIADLGLIQRGVLCQQLQKAFKLGEGHVLKCRLCQLKGFICEICQSPRV
LYPFHISTTFRCLTCGAVFHAECLNEKQPCPKCERIRKREDQGLQEAVQCLKQKNEVA
Download sequence
Identical sequences XP_016928631.1.48971 DS10_00003518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]