SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004040 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004040
Domain Number 1 Region: 76-156
Classification Level Classification E-value
Superfamily HMG-box 6.68e-28
Family HMG-box 0.000012
Further Details:      
 
Domain Number 2 Region: 528-605
Classification Level Classification E-value
Superfamily HMG-box 1.96e-27
Family HMG-box 0.00000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00004040
Sequence length 792
Sequence
MQNFSSGAGSVAGGSANSHHSAPASSSVMAAAAAAHLHHNSQASPISNLHQNMGSLMNSG
SSASDVFFSLMIQNTTKRQNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGA
EWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKALRRDGYPYPMPYPSVPVEA
LRAGITPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATLSGQMDKFALERSSYLSNSSQAS
AYSAYLDPSVLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQ
QQQQQLLLSGGGGGGGGSGGGGSASSHNNNSSSGLDDRDATPQLEAVEAKPHLHSPSDVG
LDYAQYAGQYGAIGHKTRFKKARGAAVPPDNYHLQPSIEVPFGAAAIEEPPGIMASISAL
LHRSHSHSNGYTSSGSSNHSHSSSLSPQLPGINLGLGMVGGSGSGNTTPPILPPVDLAIS
TAATPPTPVAPPKMHHQHQHPHHHASAHQNSHSNSNPGSHHNNSNSHDHIKRPMNAFMVW
SRGQRRKMAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHMKEHPDYKYR
PRRKPKTLNKSPVPGGGGGGGSNGGANGGGNPGSGGPGSIGSPKDMQPQLSPLGQNMPHL
HGHPHQSSYPPHPHHPHPHPHHVQLAAATLSAKYGFGSPLELSLPRLPNAFPGLAHYPLD
PTLALDLQARLQAMYAGSIYHPWRYLPLISPETPPSPPSSSGTGISSYGCVKSEKSSPNA
VVATTASPPNII
Download sequence
Identical sequences DS10_00004040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]