SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004098 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004098
Domain Number 1 Region: 721-754
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000915
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 2 Region: 803-848
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000513
Family Ovomucoid domain III-like 0.0095
Further Details:      
 
Weak hits

Sequence:  DS10_00004098
Domain Number - Region: 856-888
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000208
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number - Region: 669-735
Classification Level Classification E-value
Superfamily FnI-like domain 0.000795
Family VWC domain 0.065
Further Details:      
 
Domain Number - Region: 899-928
Classification Level Classification E-value
Superfamily FnI-like domain 0.0638
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004098
Sequence length 1069
Sequence
MRLSGWEIVLLLLPFGLVSAVRQLEENQSTKSDHLHSGERQVRRRNNKSNASVDHQRHSP
SSGSKKNGRSQSVSLDSDDYDWLDADTSEAIDSSEFTALESVKSSGETHDIFTCCNQVFG
SCRTACENLSLVEFATGAGGDNREELRKYCQLHQVEFWTCVNQTFDAVTRGADWSGRRCC
QFGVLPHCRNVCATSNRSPVQNCRRSDEQMLYDCLERQEAADQCCGQARTSECLEACRAV
FEPANDNHDHVDINGSCGDRNADVIQCINNHTDMTPLANAEQYLPCCEYSNKEHCRHTCR
NLLHQNATLMERSEVIFSRLEAAGCGSPLPQLPFWQCFLTVTGKLYVPGGTGRAGGSLAQ
GRVSGKGGSLGEPNHLGMDAAKRQCCEQAGSHKCRRLCNQIFTSNWWDARSSFENECMDQ
PGERELRRCIESVDAPCELGCQGLSFCSNFNNRPTELFRSCTAEHDAAAREDLQLLQQRG
TVRVLGQELFIKNTSRCAPEKWQALVCALQLKPCTRMGLFNGICSEDCHELLDECLDWTL
QSQRPKDICSRLKEKDEDDPLPCISLESYLKPGAASPEESQGITSPCAKKPCNGSEVCIL
QRGGNQGYSCIPGCNLGQDSKLFVPFGSYVRLGKSTLHKKSEVGQLPLAEHIVCSCGLEG
RLEQCQPLPSYMHSHCILPGARSYRHGSSFYLECNLCSCFAGEITCTKQQCRLPGFADSG
YTSLPCNCPAHYVPVCGSNGNTYPSACVAKCHLPEGDYVYGACNARNACQAAPPNSCPSG
TQCLDSRKVCLASMQRPCLQYVCVNATASNCSSFHQGEVCDTQGRTHQNACELLRANPQG
QVAYWSACQTSRYASPSPVCGINGVTYKSIYAARSEYVLVDYVGRCREVGLLASDMGRRC
RTVQCPAPASKHCRLIVPPGACCPLCAGGAFRIIYSRKQFDRAMYGLRAQSSTLLTLHGV
LQQLDGLVQVSECQLTGFLTMEVGIFVAVVPASSIKRPTRLQLEACAREAEKISSLINAQ
SPRITTNLALSCLTVSHLLEPTPNGATSYGSHTIWILPLLLLILRLIIA
Download sequence
Identical sequences XP_016934785.1.48971 XP_016934787.1.48971 DS10_00004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]