SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004180 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004180
Domain Number 1 Region: 2915-3086
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.29e-32
Family Laminin G-like module 0.00089
Further Details:      
 
Domain Number 2 Region: 2710-2896
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-29
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 3 Region: 3100-3264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-27
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 4 Region: 3372-3558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.73e-26
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 5 Region: 3564-3752
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-24
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 1955-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 579-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 8 Region: 1504-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 9 Region: 1905-1957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family EGF-type module 0.072
Further Details:      
 
Domain Number 10 Region: 1847-1899
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1413-1461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 12 Region: 533-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 13 Region: 670-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 14 Region: 770-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 15 Region: 2008-2057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 16 Region: 333-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 17 Region: 1552-1600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000026
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 18 Region: 1465-1501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 19 Region: 273-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000339
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 20 Region: 2055-2104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 21 Region: 441-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 22 Region: 486-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 23 Region: 715-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 24 Region: 823-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000477
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 25 Region: 1812-1849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Laminin-type module 0.055
Further Details:      
 
Weak hits

Sequence:  DS10_00004180
Domain Number - Region: 625-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 403-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 2102-2149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 2474-2704
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0706
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00004180
Sequence length 3753
Sequence
MGLRMASIGFLLLILAISYCQAELTPPYFNLATGRKIQATATCGQDTDGPELYCKLVGAN
ADEDHVDYSVIQGQVCDYCDPSNPEKNHPPENAIDGTQAWWQSPPLSRGMKFNEVNLTID
FEQEFHVAYLFIRMGNSPRPGLWTLEKSTDYGQTWAPWQHFSDTPADCETYFGKDTYKPI
TRDDDVICTTEYSKIVPLEGGEIPVLLLNGRPSSTNYFNSTVLQEWTRATNIRIRLLRTK
NLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQH
HTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSTDCKYDEEVNRKGLSLDIHGH
YDGGGVCQNCQHNTVGINCNKCKPKYYRPKGKHWNETDVCSLLIIENCQHNTVGINCNKC
KPKYYRPKGKHWNETDVCSPCQCDYFYSTGHCEEETGNCECRAAFQPPNCDSCAYGYYGY
PNCRECECNLNGTNGYHCEAESGQRCPCKINFAGDYCKQCAEGYYGFPECKACECNKIGS
MGNDCNVTTGVCKCLTSFGGDNCERCKHGYYNYPTCAYCDCDNEGTESEICNKQSGQCIC
REGFGGPRCDQCLPGYYNYPDCKPCNCSRTGSSAITCDNTGKCNCLNNFAGKQCTLCTAG
YYNYPECLSCNCDSHGSQGVSCNSDGQCLCQANFDGRQCDTCKEGFYNFPSCEGCNCDPA
GVISKFAGCGSVPVGELCKCKERVTGRICNECKPLYWNLNISNTEGCETCDCWTDGTISA
LDTCTSKAGQCPCKPHTQGRRCQECRDGTFDLDSASLFGCKDCSCDVGGSWQSVCDKVSG
QCKCHPRITGLACTQPLTTHFFPTLHQFQYEYEDGTLPSGTQVRYDYDEEAFPGFSSKGY
VVFNAIQNEVRNRLNVFKSSLYRIVLRYVNPNSENVTATISVTSDNPQEVDQHVKVLLQP
TLEPQFVTVAGPLGSKPSAIVLDPGHYVFTTKANKNVMLDYFVLLPAAYYEAGILTRHIS
NPCELGNMELCRHYKYASVDVFQPAGTPFVIGANAKPTNPLEVYSDPEHLQIVGHVGDIP
VLSQSQKELNYIVDVPRSGRYIFAIDYISDRNFPNSYYINLKLKNNPDSETSVLLYPCLY
STICRTSVNDNGMEKSFYISKDDLQPVVIYADIDDESRFPIISVTAIPAEEWSIDYINPS
PVCVIHNDQCATPKFRSVPDSKKIEFETDHEDRIATDKPPYASFDERVKLVHLASPEEGT
IVIESKVDAAKPNLFVILVKYYQPNHPKYQVYYTLTAGKNQYDGKFDIQHCPSSSGCRGV
IRPPGEGSFEIDDEFKFTITTDRSQSVWLDYLVVVPLKQYNDDLLVEETFDQTKEFIQNC
GHDHFHITHNASDFCKKSVFSLTADYNSGALPCNCDYAGSTSFECHPFGGQCQCKPNVIE
RTCGACKSRYYGFPDCKPCECPSSAMCEPSTGECMCPPNVIGDLCEKCAPNTYGFHQVIG
CEECGCNPMGIANGNTQCDLFNGTCECRDNIEGRACDVCTHGYYNFPHCQQCSCHKPGTE
LEVCDKVDGTCFCKKNAVGRDCDQCIDGTYNLQDSNPEGCTTCFCFGKTSRCDSAYLRVY
NVSLLKQVTISTPEFREESIKFEMWPVPAEEILLNETTLKADFTLREVNDERPAYFGVLD
YLLNQNNHITAYGGELAYTLHFTSGFDGKYIVSPDVILFSEHNVLVHQSYEQPNRNEPFT
NRINIVESNFQTVSGKPVSRADFMMVLRDLKMIFIRANYWEQTLVTHLADVYLTIADEDA
DGTGEYQFLPVERCSCPPGYSGHSCEDCAPGYYRDPSGPYGGYCIPCECNGHSDTCDCAT
GICTNCQHGTQGEHCEQCVSGYYGNATNGSPGDCMICACPLPFDSNNFATSCEISESGNE
IHCECKPGYTGPRCESCANGFYGQPENLGEVCKPCECSGNINPEDQGSCDTRTGECLRCL
NNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTQECDPFVGICTCNENVIGERCDRCK
PDHYGFESGMGCRACDCGAASNSTQCDMHTGHCACKSGVTGRQCDRCAVDHWNYDKDGCT
PCNCNQGYSRGFGCNPNTGKCQCLPGVIGDRCDACPNRWVLVKDEGCQECNNCHHALLDV
TDRMRYQIDGVLADFSSVTLAFFTSQKLNYYDQLADELEPKVKLLDPNSVDLSPSKQENS
ELETEAKSYAKQVNQTLANALDIRERSSTTLGNITVAYDEAIKSAGQAKEAISAVEALSK
NLEAAASTKLDAALEQAQHILGQINATSIELTPNEQVLEKARKLYEEVNTLVLPIKEQNK
SLNALKNDIGEFSDHLEDLFNWSEEAQAKSADVERRNVANQKTFDNSKFDTVSEQKLQAE
KNIKDAGHYLINGDLTLSQINQKLDSLRDAFVDLTSVNKHVDDDLPLREEQHNEADALTA
QAELKADELAVKAQDLAAQYTDMTASAEPAIKAASAYSGIVEAVDAAQKLSQDAIAAAGK
ATEMTDGIEERAGQADTGSADLLQKARQSLQKVQDDLEPRLNGSASKVQKISAVHTATEQ
QLRDINALIEQLPAESQRDMWKKSNANASDALEILKNVLEILEPVSAQTPKELEKAHGIN
RDLDLTNKDISQSNKQLDDVEGSVSKLNELAEDIEEQQQQVGAQTLQLGQEIENLKAQVE
AARQLANSIKVGVKFKPSTILELKTPEKTKLLATRTNLSTYFRTTEPNGFLLYLGNDNKT
AQKNNDFVAVEIVNGYPILTIDLGNGPERITSDKYVADGQWYQAVVDRMGPKATLTIREE
LPNGTVVDHKKSAPLEGSQNILHVDKNSRLFVGGYPGISDFNAPTDLTTNSFNGDIEDLK
IGDESVGLWNFVNGQENEEGARERDVLLEKKKPVTGLRFKGNGYVQLNATSNFKTRSSIQ
FSFKADKDTSNGLLFFYGRDKHYMSIEMIDGAIFFNISLGVGGGVQSGSQDRYNDNQWHK
VQAERENRNGLLKVDDIVISRTNAPLEADLELPKLRRLYFGGHPRRQNNSISLQPNFDGC
IDNVVINQGVVDLTEYVSGGGVEEGCSAKYSTVLSYAPHEYGFLRMNNISSDNDLHVVLH
FKTTQPNGVIFYAANHDQSSNIGLSLQDGLLKLNSMGSQLVVDDLILNDGEDHVVTVQHI
QNELRLSVDDVEHRRFGSPQPLILEGGDIFFAGLPDNYRTPRNALASLAYFVGCISDVTV
NNEVINFANSAERKNGNINSCPPHVLAYEPSLVPSYYPSGDNEVESPWPNPETLPPLKPD
IEATEAPTWPTTTATSTTTTTTTTTTSTTTTTTSTTQAPIFFDADKDQEFRAPPKTLTTR
PPAKLNLPSDERCKLPEQPNFDVDFAEAGYRFYGLREQRLEITSLPVKLRRQHDIGISFR
TERPNGLLIFAPSIKQREDFIAVYLLDGKVTYEIRVGALLEAKITSEAELNDGSWHSVEV
VRTQRKVTLLIDKLEQAGSVDLSTERSPPLFDVQLPIYVGGVTKFLEPEVKKLTGFVTDV
PFYNGCLKNIKFNAVDLETPPEEYGVVPCSEQVERGLFFNNQKSFVKIFDHFDVGTEMKI
SFDFRPRDPNGLLFSVHGKNSYAILELVDNTLFFTVKTDVKNIVSTNYKLPNNESFCDGK
TRNVQAIKSKFVINIAVDFISSNPGVGNEGSVATRTNRPLFLGGHAAFQKAPGIRTKKSF
KGCISKVEVNQKMIDITPDKVVGDIWQGYCPLN
Download sequence
Identical sequences DS10_00004180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]