SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004537 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004537
Domain Number 1 Region: 399-582
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-44
Family CRAL/TRIO domain 0.000058
Further Details:      
 
Domain Number 2 Region: 99-282
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-37
Family CRAL/TRIO domain 0.00025
Further Details:      
 
Domain Number 3 Region: 318-390
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 3.66e-18
Family CRAL/TRIO N-terminal domain 0.0057
Further Details:      
 
Domain Number 4 Region: 16-89
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000105
Family CRAL/TRIO N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00004537
Sequence length 615
Sequence
MIGSFKTIRPLPPALQKVAIEELNEVPSRVESDIATLKEWLQKQPHICACLEDQFLLSFL
RGSKFSLEKAKQKIDRFYSLQAAIPEVFNEHRLADDPQVLEIIRMGVILRIPLDKEDTGP
AVTIIRAGSYDLNKFKFQDILRVGSMFGEIMMLEDDNASVSGYVEIMDMSGVTGANLFAL
QPHLLSKFSAYADEAMPTRQKGIHFINVPKAFEIGFKSLLGWFPEKIKERLSVTADPEAI
FEQVPKHYLPLEYGGSNGTMKDMATEMEAKLSSYRSYFEDCQHFGTNDKLREEPTNLSPE
ENLNEMPSIRPLSPELQKNAIQILNEVPKKLDDDIAALRDWIRQQPHLKARTDDQFLVNF
LRGCKFSLERTKAKIDRFYTLRTKYPEFYLGHNVDVEKLLDIFKLGTLVILPRPLNDNGP
RLAMIRMATYDPSKYTFQEVNRAGGLMQQIMLDEDDVAIVNGLITILDLSNVTTGHFLQM
TPSFAKKMTVFQEEALPLRPQGIHFINTPNGFETIFNMIKPMMSKKQQGRLYVHGTKWEA
LYDQIPKKYLPVEYGGENGSIPELIKDWEQRILAYRNYWEEEKNYGTDESLRVGQPVDFE
SLFGLQGSFRQLNVD
Download sequence
Identical sequences DS10_00004537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]