SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00004695 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004695
Domain Number 1 Region: 524-556,643-710
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000144
Family RUN domain 0.013
Further Details:      
 
Weak hits

Sequence:  DS10_00004695
Domain Number - Region: 26-58
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0314
Family Troponin I 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00004695
Sequence length 719
Sequence
MAEAQESKDFSSTVEGQLPAGSVPVEKEEEEVEAEVEQEEQEQQELLSERWSPLGANYDD
ANSASSGVDCELEPGLEKSETRRGSTGSELARLRSIEEEQELLTSSLLALTSHFAHVQLR
VRQIVEAPAEERDQLLRDLEDFAFQGIPEAVQSKESQPEDDAVEGEKEPGADSQLIEQLK
SQLTELEQIAYEAGEPGILPQHVMLEKQKFILDELRSKLNLQVEQHELPALSTEQLRHQV
DNAIGEFVGPLKMKEQLVAQLKTQITDLERFIAFLQCDAVEGSVGDRLKLLSGAYNSYAA
KQTARSSQAASIAPATGVASAPATTAAPPPYSGVGSHSPGESLHSKAHGLLDKASILMQM
FASTHLGKPRSHDEFQQNSLKKTHKGNHWGDLRAQLEVDIQEVAALAATLSCDREKLANI
KRALRQQHQQQAECTSSSAAGHLVINSQSGALTTLPLRCRRAVPTGHELAPYAAGGAISS
DSDEDISYSNFEWEKEGKSRRTAHMRGDSIATIGRELTTVVRKNFARTLQQLIQHGLRIP
AESAASSLMVPFMRCLHPAPPMVPPSAGGDSQFLGLGRAMHAWELVLAYYRLKHGEEYNN
TPARKLSQSFQLDIVDAQAVTAKQSLLSAVGMILAMHRPYKRSNNAHFKAFVCAGLNSHL
LVEWLNLILSCHELVDTYYSANSYVARTGFRDSLRSIDALSRFDFDLPVDLAIRHFRNI
Download sequence
Identical sequences DS10_00004695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]