SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00005214 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00005214
Domain Number 1 Region: 3598-3809
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.18e-36
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 4110-4318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-29
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 3 Region: 3857-4055
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-26
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 2760-2844
Classification Level Classification E-value
Superfamily Immunoglobulin 7.31e-16
Family I set domains 0.0084
Further Details:      
 
Domain Number 5 Region: 2851-2948
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 2923-3008
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000875
Family I set domains 0.062
Further Details:      
 
Domain Number 7 Region: 2566-2654
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000266
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 1279-1360
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000337
Family I set domains 0.053
Further Details:      
 
Domain Number 9 Region: 2472-2556
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000665
Family I set domains 0.039
Further Details:      
 
Domain Number 10 Region: 3130-3215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000851
Family I set domains 0.0067
Further Details:      
 
Domain Number 11 Region: 2664-2754
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.049
Further Details:      
 
Domain Number 12 Region: 3447-3538
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000452
Family I set domains 0.044
Further Details:      
 
Domain Number 13 Region: 1038-1123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000612
Family I set domains 0.021
Further Details:      
 
Domain Number 14 Region: 1204-1240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 15 Region: 911-951
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 3540-3611
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000186
Family I set domains 0.027
Further Details:      
 
Domain Number 17 Region: 194-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 3335-3376
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 277-317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 20 Region: 1162-1200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 3797-3839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 485-521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 611-647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 24 Region: 832-869
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 25 Region: 975-1013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 26 Region: 872-906
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 435-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 28 Region: 531-569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000916
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 3222-3293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000168
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 30 Region: 705-740
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 31 Region: 26-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 32 Region: 1248-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 109-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 2005-2048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 35 Region: 797-830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 36 Region: 650-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000103
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 66-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 38 Region: 757-799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 39 Region: 574-610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 40 Region: 1662-1710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.056
Further Details:      
 
Domain Number 41 Region: 1966-2007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.071
Further Details:      
 
Domain Number 42 Region: 400-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000089
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 43 Region: 3047-3150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000922
Family I set domains 0.064
Further Details:      
 
Domain Number 44 Region: 2314-2351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000225
Family Laminin-type module 0.092
Further Details:      
 
Weak hits

Sequence:  DS10_00005214
Domain Number - Region: 149-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000367
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 2086-2123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1597-1628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00605
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 1723-1764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00005214
Sequence length 4330
Sequence
MSFVLSCHFDVNCWQCLHSRKSRAKNKCLATEFRCNNGDCIDARMRCNHIADCSEGEDEN
EECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDADDEEHCDGIVPKLRYTCPKGKFTC
RDLSCISIVHRCDGRADCPNDRSDEEGCPCLYDKWQCDDGTCIAKELLCNGNIDCPEDIS
DERYCEGGYDDEECRPGDFRCGTGECIPMRQMCDNIYDCNDYSDEADCAEEQDSVGIPIG
HQPQRPRPNDWLNELDANEYHVYQPSNVYGTANSKNPCASNQFRCTTSNVCIPLHLRCDN
FYHCNDMSDEMGCEQYERRSTTRRPLTSARPSFTTEGPGQLERRNTTRTTGSTSRATESP
HWPWPAVTRTTPAARTTETTTTNPITTAGVASNSPQSCLENIEFACHNRDCIPIESVCDG
IPDCGRDEDEDDALCKCTADKFKCQRGGGCIPKTQVCDGKPHCRDRSDESACHLHGRSNK
TRLGVQCLENQYQCGDGSCISGYKRCNGISDCDDAADEYDCNYNYDNYPDPLNECDILEF
ECDQGLCLPLEKKCDGYADCEDLSDEVECQSYTENCLMSEFECDGYCLPRDQLCNGIINC
QDGSDERNCTFCREDAYLCITGECVAVNQRCNGIVDCVDGSDERHCARIYCPPNKLACNG
TCVTRRIKCDGKRDCLDGYDEMYCPVRNTTENNYHYPTQKPSPRPNSCRPHQWQCANFEC
IESRLQCDDFKDCSDGSDEDLSICFGTATTRLKPSDCSTDQFFCDESCYNRSVRCNGHMD
CSDGSDEVGCSLQSLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCTAILCKDNEFL
CFDRQFCINATQHCDGFYDCRDFSDEQNCIGCYGDQFRCNNGDCVSGSAHCDGKVDCSDQ
SDELDCGGDVQCLPNQFRCKSGQCVSATARCNRRTDCHDSSDEENCGLHHVEVIQGTTGS
TTSTSTSSTATTPLRIICPPTSFKCENGPCIALGLKCNGQADCPYDSSDEADCGQISNDI
DPNEPNSPGRGSSQLKLRTYPANQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPTGF
TDRNGRLEIPNIRVEDAGTYVCEAVGYANYIPGQHVTVNLNVERSWGEHKYEELRSNRIR
YGTVPHIDLEFFGLANDLESRPDAACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSC
SLGLRCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGH
CIPKSFQCDNTNDCKDTEPSPMKLSPPAVVVMEYEVLELTCVGTGVPTPTIVWRLNWGHV
PDKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRTDVCEAG
FFNMLARKSEECVKCFCFGVSTACDSANLFTYAIQPPILSKRVVNVELSPLRQIVINEAS
PGQDLLTLHHGVQFRASNVHSSGRETPYLALPSDYMGNQLKSYGGNLVYEVSYMGNGRPV
SGPDVIITGNRFTLTHRVRTQPGQKNKVKIAFLPGGWQKPDGRKATREEIMMILANVDNI
LIRLVYLDTTAREVDVVNIALDSAGSADTGLGSASLVEKCTCPPGYMGDSCESCASGYVR
QARGPWLGHCVPFIPEPCPSGTYGNPRLGVPCKECPCPLTGSNNFANDCKQSPDGDVVCR
CNEGYSGRRCEHCASGYQGNPLVPGGVCRKIPDTSCNVDGTYNIHSDGTCQCKDSVIGEQ
CDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRNQVTSTFGRSRVNHGFALVTDY
MRNTPETVPVSMSPQTNALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSP
LPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVANTYSVEIKESAWQRGDEVIANRE
HVLMALSNITAIYIKATYTTSTKEASLRQVTLDTATATNLDTARAVEVEQCRCPEGYLGL
SCEQCAPGFTRDPEGGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGPNCERCAAGF
VGDATRGTSYDCQYEDGYPTRPLAPGNQTADCAAICQPEGTYACRGSECQCKRNVYGDRC
DQCRPGTYGLSAQNPEGCKECYCSGLTTQCRSASLYRQLIPVDFILTPPLITNDYGEIMD
TLNLIPDISNNIFTYAHESYTPKYWSLRGSVLGNQLLSYGGRLEYRLIVESIGHDHRGQD
VVLIGNGLKLIWSRPDGHQNQEDYHVRLHEDEQWTTQERGSARPATRSDFMTVLSNLEHI
LILATPKIPTERTSISNVILESAVTTRTPGATHASDIELCQCPPGYTGNSCESCAPLYYR
DNNGACSPCPCEASNTESCGLVSGGFVECRCRPRWRGDRCREIDTSPIIEEPPQICDLSR
GFCCSGFQFDIAPNETISFNDTLQIYKGNRIIGNMTKLRYGCPSRETNEPTPGPDPSTDD
HVRSQIIVSIAKPEISIVPVGGSLSLSCSGRTLWSNSPVFVNWYKENSRMPVNYDLEGGE
LRLYNLQISDSGIYICQAKNNETGHIFTDNVVITVTPKDQRSAAEIVDLPSQVTFEEYTR
DEIICEVRGNPPPTVTWTRVDGIEAQSTRTYGNRLVFDSPRKSDEGRYRCQATNDQNRDE
KYVIVYVESNPPQPPPPQDRLYITPEMYNGLAGETFQLQCQFTSAASLRYDWSHDGRSLS
ASPSRNVQVRGNVLEVRDSTVRDSGIYTCVAFDLRTRRNFTESAHVYIEPAGEPPILGDK
PQILSLEQNIVVVQGEDYSITCEASGSPYPSIKWAKVHDNLADNVHISGNVLTIYGARLE
NRGVYSCIAENTHGSDQSSTSIDIEPRERPSIKIDSPQQPVLVGSQASLYCAVDGIPEPT
VEWVRADGQPLSPRHKIEGPGYVVIDDIQIADSGAYECRASNSIRLTVGDELSLTCVGSG
VPTPSVFWSYPEQGRASVQRNEFGQRPAGNSADIKIYRMTKEDEGIYTCHGSNLAGDDQR
YIRVEVQERRGDIGGDEDPDVDGDRRSPGHPNRPIVQEPANDRLGAGVGDNVTLTCDIEN
VETQWERVDGAPLPSNAYTMRNSLVIVYVEPHNLGQYRCNGIDRDGNVVAQVVRELTLLP
LPRITFYPKIPLTLEPGQNLDVYCQVENAHPDNVRWTTDNNRPLSSSVRIEGNVLRFTAI
TQAAAGDYRCTANNEYGTRSESARVTVKKPGVFQTVPPVPGSQVQQRRVGETIQLRCSLT
NQYGGDHRGNIQFNWYREDNRELPHNVRPDTQVLELTKLQPEDEGRYICNSYDVDRRQPL
PPVSIDLQVLNFKSSKFSPSKPLNSGPATIRTPTISYTCQPNDFKCVSHPHTCIRSNMVC
DGIYDCTDHSDEFNCIAGKGSGKSGSNSGSGNFKRWKKDQQLRRRSLVKAFKDRKLRKRS
SVATPPPSYLPPVATAPPRSTGWIREPQLTLSEQSSNLPAGEGTTIECYSSDDSYPNVMW
ERADGAPFSDNVRQVGNNLVISNVASTDAGNYVCKCKTEIEGDLYTTSYQLEVEDQPHEL
KSSKIVYAKVGGNADLQCGADEDRQASYRWSRQYGQLQAGRSLHNEKLSLDRVQANDAGT
YVCTAQYSDGETADFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENGD
GLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALNEWHTVRVSRFKRD
GYIQVDEQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLT
LQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRNCAIE
GNQCTPGVCGAGRCENTENDIECLCPLNRAGDRCQYNEILNEHSLKFKDNSFAAYGTPKV
TKVNITLSVRPSSLEDSLILYTAESTLPSGDYLALVLRGGHVELLINTAARLDPVVVRSA
DPLPLNRWTRIEIRRRLGEGILRVGDGPERKAKAPGTDRILSLKTPLYVGGYDRSTVKIN
RDVNITKGFDGCISKLYNFQKVVNLLADIKDAANIQNCEETNEIGGEVDSVDNEPPVPPP
SPAVQESERQEMAPCASDPCENGGSCSEQENLAICSCPFGFSGKHCQNHLQLGFNASFRG
DGYVELNRSHFQPAVEQSYSSIGIVFTTNKPNGLLFWWGQEAGAEFTGQDFIAAAVVDGY
VEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLEVDQILDTGDTRPTLNKAMK
LPGNVFVGGAPNVASFTGFRYTDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDE
PLGGTEPPVV
Download sequence
Identical sequences DS10_00005214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]