SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00006233 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00006233
Domain Number 1 Region: 532-896
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.16e-111
Family Histone deacetylase, HDAC 0.000000891
Further Details:      
 
Domain Number 2 Region: 105-463
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.06e-106
Family Histone deacetylase, HDAC 0.00000185
Further Details:      
 
Domain Number 3 Region: 985-1082
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-25
Family Zf-UBP 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00006233
Sequence length 1129
Sequence
MSPPIVTRRSAQQAKIQTRAMASKSKAGSTAATAAGVIGSSAGGGSGGISGGINAADPRK
ANKPSAALLEAKRRARNMLKNQSNAMQECVTDIFQNAVNCKGLVRKPTALIYDESMSQHC
CLWDKQHYECPERFTRVLERCRELNLAERCLELPSRSATREEILRLHTEEHFDRLKQTSG
IRDDERMEDLSSRYDSIYIHPSTFELSLLATGSTIELVDHLIAGKAHNGMAIIRPPGHHA
MKAEFNGYCFFNNVALAAQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHR
FEHGSFWPHLHESDFSAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPE
LIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADSRVAVVLEGGYCLDSLAEGAAL
TLRSLLGDPCPPLVEALPLPRAELTQALLSCIAVHRPHWRCLQLQKTYDSSELLDQEKGQ
DLHKVLRLWIGGPPPVDRYPTRDTAIPLPPEKLARNTARLQVLRTETKLSMPSVRVCYAY
DAQMLLHCNLHDPGHPEQPSRIQHIHKMHDEYALLSRMKQLAARAATTDEVCLAHTRAHV
NSVRRLMGRDPEDLHQVSTGYNSVYLHPRTFDCATLAAGSVLQAVDSVLRGESRSGICNV
RPPGHHAEQDQPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKA
LYISLHRYEHGAFFPKGPDGNFDVVGKAAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPI
AYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALAGGRIIVCLEGGYNVNS
ISYAMTMCTKTLLGDPVPTPQLGAAALQKPPTVAYQSCVESLQSCLQVQRNHWQSLEFVG
RRLPRDPVVGENNNEDFLTASLQQLNISNDNAPGAVGGPAGDQPDCGDERPSGSKPKVKV
KTLTEYLAENKEALEQNEMFAVYPLKTCPHLSLLRPEEAPQSINSGAACSVCGSTGENWV
CLSCRLVGCGRYVNGDMELHAVEAQHPLAMSMADLSVWCYVCSSYVDHPCLYAYLNPLHV
DKFQEPMAWTHACPKREDGRYPLGADGRNEEDDDVAGSSICFRLERQNN
Download sequence
Identical sequences DS10_00006233 XP_016924053.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]