SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00007394 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00007394
Domain Number 1 Region: 41-273
Classification Level Classification E-value
Superfamily L domain-like 1.07e-36
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 270-365
Classification Level Classification E-value
Superfamily Immunoglobulin 5.43e-16
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00007394
Sequence length 797
Sequence
MESRRSRTPRALPVCWILVCLVAWTLADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIP
NTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEI
DLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDP
MSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSR
LSSVSLVCKGPPAQKDRSWDSVDDDLFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDP
LPEVAWELNGKILDNDNVLFDSESISSDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQ
NISIYLSEIVQHVLEKTPETFWYFGLIMGIFGTVFLLISISFVVCLCKRTTRQHRHANKA
GVKSSVSFNDQEKKLLDSSVTTTTNDRGDSYGIDNQPTSIGMNKADSAGMGFNQIEIHAV
DSHRHGSMLVQQQPQQQQIQGGPGMRQQLMQVKDPTCGMMSVPTSMAGHTHSHPSQISEE
FPLNVGVFPPPPEFCSNIVPNPAFGGNIFIRVSVTQDMLDGADLNMYPDLLNIPKRMQDV
QESGAGTVAVPEEGQLQQQQQLQQQHQQLQQQHQPSGLYTHDEIVTYNLEASGYDPHQSA
YHSNPMELPPPPPPPAVTAVVQCHHPSPSNCASCINNAQQPPSACQTPPVEVTPMRPLDS
SAYPKYDNMGRRITASGGLGGSNLSLPDEERYENETLFGQADGQPTGIPEQSQDLHQPQE
ATQGQDKGGGPGEFVSL
Download sequence
Identical sequences DS10_00007394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]