SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00007967 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00007967
Domain Number 1 Region: 690-976
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.41e-42
Family Eukaryotic proteases 0.0015
Further Details:      
 
Domain Number 2 Region: 388-427
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 93-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 247-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 525-558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 2-34
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 598-642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000625
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 8 Region: 136-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 9 Region: 290-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 10 Region: 39-73
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 465-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000222
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 12 Region: 343-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000759
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  DS10_00007967
Domain Number - Region: 189-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000114
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00007967
Sequence length 983
Sequence
SQFECDNGSCISQYDVCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCTYGACVIGTAGC
NGVKECADGSDETVLSKSLLSVRTLFTNHLLFSECDNSQFECDNGSCISQYDVCNGEKNC
PDGSDETALTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVKECADGSDETRLRCGNEDDI
RQHDRRLQGNCQDNEFKCPSGICLDKGNFLCDGKDDCADGTGFDESVDLCGHMECPAYSF
KCGTVFSECDNSQFECDNGSCISQYDVCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCT
YGACVIGTAGCNGVKECADGSDETRLRCGNEDDIRQHDRRLQGNCQDNEFKCPSGICLDK
GNFLCDGKDDCADGTGFDESVDLCGHMECPAYSFKCGTGGCISGSLSCNGENDCYDGSDE
APLLCNTTKKVTTPAPVETPLELLGCPLPIGDERPILTGEGSRILTGPIIRGTVRFSCKQ
GYVLEGEESSYCAKKKWSTSTIPKCVSKWFFLRSMVGLLSHMGFFPFGCGTGGCISGSLS
CNGENDCYDGSDEAPLLCNTTKKVTTPAPVDTPLELLGCPLPIGDERPILTGEGSRILTG
PIIRGTVRFSCKQGYVLEGEESSYCAKKKWSTSTIPKCVKYCSTSGEFDGYSTKALCTHN
GQQVECKKPFHPPGTEVKFVCSTGFKTLSSLPEMKCMKGGYWNRGRQRCEQDCGQIATPT
KSFSANGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPY
SYDTFRVIAAKFYRNYGETTPDDKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELS
HVIRPICVTFAKFAEKESVTNEVQGKFAGWSIENKHELQFVPAVSKANSECRQNLQDIQA
DKFCIFTQGKSLACQGDSGGGFTSEVQTTSFSTQNTARHYLFGIISNAPNADQCAHSLTV
LTNIQYFDDMILNAIKRSMETRA
Download sequence
Identical sequences DS10_00007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]