SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00009751 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00009751
Domain Number 1 Region: 610-986
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.02e-119
Family Oxysterol-binding protein 0.0000389
Further Details:      
 
Domain Number 2 Region: 241-364
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-22
Family Pleckstrin-homology domain (PH domain) 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00009751
Sequence length 1136
Sequence
MQPATPSTPVNNAPLAANSSSVTPVAAAPATSSASGSGGQGASSTPIRINSAKQTGGGGD
TLTQPSTPHSHSMPGTPQQQQQSSSVPTGSHLLQLQAPLPSAAGGGGAVTPSGLSMGASN
QSLGVSVGAASSVSGISITPPNSAGLRQSTVFDFKFKRRPSLKVLMTKLPSTDSLSNSPA
PSSPGEESPIGPQTIVMEVWQIRQSAADAAKLNRKESYKAQRKNYRREKKRVASELMNSL
QDPAVIVLADWLKVRGTLKSWTKLWCVLKPGLLLIYKSQKTKSSHWVGTVMLTSCQVIER
PSKKDGFCFKLFHPLEQSIWAPRGPDKETIGAVVQPLPTAYLIFRAPSQAAGKCWMDALE
LSLRCSALLLRSNSSTGAAPSSSYVGEPLPVSHETQWSEADYEKHFNDHGKWGQFLALPS
AEADTSRSDTSLSASRAPTPLLQQLYSSAVSNWERTKRLPRFGHQLEQRKTSYSDASSVE
QGMDMVQRKRRHLSPMSKSMSLGATLCNSSSSEDDDDGDYNRSQTGLRPLSAPPDCLVIP
RFRLNVKDLDADSQNEAPNAVMSGLESESESDPAEPAQEDGVEQQCEETSYVPFTEEEFG
EQGEQVEELAEENKSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLS
KAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAEQ
VSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATSP
YAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADATNVVVGKIKLGKET
LATISGHWDKECRVKDSKTGEETLLFKVDAETRSKRLTRHMVPLELQEPNESQRLWQKVS
EAIAREDQVAATEEKTVLEERQRADAKERLSTESTHMPELFEVDSYGQWLYKYADLRPWD
SRNDVRQYECQFKVLTQTRHKSVPIVHGAEMIHPLRSSIETLSRTQRQSPAGQATQKGGS
IVPKAKNKSLVLAPRDTNSDSSLSPQGAVKRSSSSAIKQLALAVDQVNRVLELHTRQLNE
ISQRLERMQYAPSPSNMGVQSHHLLGGGVSQSTVIKSLVYAFIGLMVSLILRWLFK
Download sequence
Identical sequences DS10_00009751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]