SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00009802 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00009802
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-50
Family Cold shock DNA-binding domain-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00009802
Sequence length 148
Sequence
MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCH
IRGKLRKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVT
FVEDGFDEDIEFGDEISSEDDADSVDNI
Download sequence
Identical sequences A0A1W4UK01 B3MTQ0 B3NZ80 B4GF16 B4IB73 B4JZ17 B4KD71 B4LZ28 B4NG83 B4QUG7 Q296K1 Q6XIF3 Q9VEA1
FBpp0082994 FBpp0089421 NP_001287386.1.81976 NP_524728.2.81976 NP_996231.1.81976 XP_001359311.1.19638 XP_001964385.1.52611 XP_001979664.1.56816 XP_001996271.1.65300 XP_001999392.1.58863 XP_002017101.1.64850 XP_002040983.1.34323 XP_002054611.1.90633 XP_002072314.1.14588 XP_002096168.1.41174 XP_015010268.1.56816 XP_015022352.1.58863 XP_015027741.1.90633 XP_015037768.1.19638 XP_015037769.1.19638 XP_015047210.1.41174 XP_016034179.1.80810 XP_016034180.1.80810 XP_016950939.1.21709 XP_016950948.1.21709 XP_016970908.1.97277 XP_016970909.1.97277 XP_016970910.1.97277 XP_017013419.1.47939 XP_017013420.1.47939 XP_017036026.1.37106 XP_017040081.1.74164 XP_017067257.1.81094 XP_017104997.1.53830 XP_017104998.1.53830 XP_017113632.1.32376 XP_017143974.1.22881 XP_017143975.1.22881 XP_017143977.1.22881 XP_017143978.1.22881 XP_017846649.1.30616 XP_017856239.1.65068 XP_017965792.1.46654 XP_020813569.1.32911 XP_020813570.1.32911 FBpp0238967 FBpp0251535 FBpp0196773 FBpp0126270 FBpp0281592 FBpp0173701 FBpp0185811 FBpp0082994 FBpp0089421 FBpp0217625 FBpp0270540 7217.FBpp0126270 7222.FBpp0156305 7227.FBpp0082994 7237.FBpp0281592 7244.FBpp0238967 7245.FBpp0270540 7260.FBpp0251535 FBpp0156305 FBpp0141372 FBpp0082994 DS10_00009802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]