SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00009992 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00009992
Domain Number 1 Region: 376-530
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.83e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 
Domain Number 2 Region: 531-635
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-29
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number 3 Region: 618-732
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-21
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 4 Region: 864-921
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-18
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 5 Region: 945-977,1014-1098
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000144
Family RUN domain 0.013
Further Details:      
 
Domain Number 6 Region: 147-197
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000889
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00009992
Sequence length 1130
Sequence
MDMARSIFGRDHEGYVGREEHTRKLQNLGSEDDLGELPPMMEELSVADGLRPNPGGPFSA
LTASMWPQEILAKLGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVED
AQQRLQWIAHLEFSHNKEATELSWELVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGA
LAKKQKSETSYHDIVKEIIFVRNTPAKDTRETLSLNARPGHGWRLASPTMDMARSIFGRD
HEGYVGREEHTRKLQNLGSEDDLGELPPMMEELSVADGLRPNPGGPFSALTASMWPQEIL
AKLGGGAELASGPNDQPEYRFDEFGFRVEEEDGPEQSSNKLLSIPFVEDAQQRLQWIAHL
EFSHNKEATELSWELVDVMLPRTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSY
HDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYC
QGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRLMTSKQIEKDLL
RILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMM
ATIVEDLLPASYYSSTLLGIQADQRVMQTLIANYLSSVDESLRKHDIELSLITLHWFLTL
FANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQDLKHLENSAQIFNSLSDIPGEV
TDVEVLFRQALEVGGSLSQTVIDTHRRRHLAYLMADQGHQIGNPEAAPNLPKQQLARRQV
RKSKSILEAFLFRGDASEGDQLKNKNIRQTEILVDLREAILKVGRHFITIEPKLSGHILL
TANYSTESHAKDHENFINVARTRKRRAKALHDFERHDDDELGFRRNDIITIISQKDEHCW
VGELNGLRGWFPAKFVELLDERSKLYTSAGDDAISETVTDLVRGTLAPAIKAFLEHGMKR
PTFLGGPIHPWLYIEEAATREVEKDFESVYSRLVLCKTYRLDEDGKVLTPEELLYRCVQA
INQTHDDAHAQMDVKLRSLICLGLNEQVLHLWLEVLCACQEVVQKWYHSWSFIDSPGWVQ
IKCELRILSQFAFNLNPDWELPPKRGKESQPLKDGVRDMLVKHHLFSWDL
Download sequence
Identical sequences DS10_00009992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]