SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00011343 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00011343
Domain Number 1 Region: 98-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-32
Family CRAL/TRIO domain 0.00089
Further Details:      
 
Domain Number 2 Region: 405-551
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-26
Family CRAL/TRIO domain 0.00087
Further Details:      
 
Domain Number 3 Region: 10-85
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000114
Family CRAL/TRIO N-terminal domain 0.011
Further Details:      
 
Domain Number 4 Region: 323-393
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000103
Family CRAL/TRIO N-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00011343
Sequence length 554
Sequence
MRRPLSPTLAKLAEKEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYS
LEETKRRIDRYFTHYNLFPEIMNNRCVTQRLLDINRMGICLYPDMPKGDSRTAMFIARFG
HFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKW
WNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEHIGKDS
LPEEYGGTNGHMGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGWFWHS
VSIGKSAGMATKLRPLDPQLAALAKSECNEEQSQRSEIIVTIQTWITKSPHLKAPTDEHL
ILAFLRRCRFSQEEAKRRFDNYYSLRNVFPEVLGSRQVDEALLTQLQRGIHVIPSRPVSP
EGPRVIISQFRNIDPKKSNPREAFKLVFIMLELLALECDNASISGLVWVVDARDVTMEQM
LQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS
EDLYQHLPRDAMTI
Download sequence
Identical sequences DS10_00011343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]