SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525701957|ref|YP_008233675.1| from Mannheimia haemolytica D153

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525701957|ref|YP_008233675.1|
Domain Number 1 Region: 88-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0078
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.56e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525701957|ref|YP_008233675.1|
Sequence length 205
Comment glutathione transferase [Mannheimia haemolytica D153]
Sequence
MITLHYLNSSCSHRIVWLLEALGLDYELKIYHREESGFAPMEVKALHPLGKAPVLQDGDL
VLAEGNAIIQHLIARYAEGKFEPTRGSEAYSMYHYWLSISASLFSANLVTMLANRSDLGA
FGDYAKAQTPLYFNHIEQTLSDKKWIVGDELTGADFSLCFPLQWGRNFVEMANYPNIARY
LEQVENHPAYQKANQKALKLDMNRF
Download sequence
Identical sequences A0A248ZXS7 M9X926 S9YDV1
gi|525701957|ref|YP_008233675.1| gi|526469224|ref|YP_008339453.1| gi|525663274|ref|YP_008222238.1| WP_006247870.1.100578 WP_006247870.1.101281 WP_006247870.1.14651 WP_006247870.1.15850 WP_006247870.1.18032 WP_006247870.1.19836 WP_006247870.1.21690 WP_006247870.1.22107 WP_006247870.1.24300 WP_006247870.1.25136 WP_006247870.1.2785 WP_006247870.1.28573 WP_006247870.1.29735 WP_006247870.1.33793 WP_006247870.1.34159 WP_006247870.1.34894 WP_006247870.1.39283 WP_006247870.1.42410 WP_006247870.1.42606 WP_006247870.1.43708 WP_006247870.1.45083 WP_006247870.1.47009 WP_006247870.1.50719 WP_006247870.1.52776 WP_006247870.1.55804 WP_006247870.1.61638 WP_006247870.1.62250 WP_006247870.1.63192 WP_006247870.1.63974 WP_006247870.1.73398 WP_006247870.1.73782 WP_006247870.1.73864 WP_006247870.1.74727 WP_006247870.1.74925 WP_006247870.1.76946 WP_006247870.1.78880 WP_006247870.1.8019 WP_006247870.1.802 WP_006247870.1.81289 WP_006247870.1.82341 WP_006247870.1.84529 WP_006247870.1.90102 WP_006247870.1.91740 WP_006247870.1.93146 WP_006247870.1.94296 WP_006247870.1.95684 WP_006247870.1.95739 gi|482887266|ref|YP_007884439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]