SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525703494|ref|YP_008235282.1| from Mannheimia haemolytica D153

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525703494|ref|YP_008235282.1|
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.5e-46
Family Glutathione peroxidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525703494|ref|YP_008235282.1|
Sequence length 160
Comment thioredoxin-dependent thiol peroxidase [Mannheimia haemolytica D153]
Sequence
MEKLQMNILQAGDKAPKFTLQNQADEPVSLSQFAGKKVLVYFYPKALTPGCTTQACGLRD
SKSELDELNVVVLGISTDLPKKLAQFVEKKALNFTLLSDPDHQVAEAFGVWGEKKFMGKT
YDGIHRISFLIDEQGGVEQVFDKFKTGEHHQMIVDYLRGR
Download sequence
Identical sequences gi|472334396|ref|YP_007666671.1| gi|472336104|ref|YP_007668378.1| gi|525703494|ref|YP_008235282.1| gi|526468240|ref|YP_008338365.1| gi|525664799|ref|YP_008223820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]