SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|509150587|ref|YP_008062961.1| from Legionella pneumophila subsp. pneumophila str. Thunder Bay

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|509150587|ref|YP_008062961.1|
Domain Number - Region: 5-49
Classification Level Classification E-value
Superfamily Sec7 domain 0.0275
Family Sec7 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|509150587|ref|YP_008062961.1|
Sequence length 65
Comment hypothetical protein LP6_1248 [Legionella pneumophila subsp. pneumophila str. Thunder Bay]
Sequence
MMDKRVFKEVEAANYICMSRSFLSQDRVNGTLKNRTPGPKFIKIGRAIRYLKEDLDIWLD
LHRKP
Download sequence
Identical sequences gi|509150587|ref|YP_008062961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]