SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656003|ref|YP_008219365.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656003|ref|YP_008219365.1|
Domain Number 1 Region: 90-226
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.16e-35
Family DsbC/DsbG C-terminal domain-like 0.00000131
Further Details:      
 
Domain Number 2 Region: 21-77
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000000419
Family DsbC/DsbG N-terminal domain-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525656003|ref|YP_008219365.1|
Sequence length 227
Comment protein-disulfide isomerase [Mannheimia haemolytica D171]
Sequence
MKKNLITLGLMCLSTITFASDAKLKSQLEKIGATDVKISDSPLTGFKMATSNEGVVYISQ
DGRYVIQGKVFELKNGKAIDITNQGLLAELNSYTNEMIVYPAKNEKHVITVFMDITCHYC
HLLHTKIKEYNDLGITIRYLAFPRGGMNTQTAKQMEAIWTSADKVKALNDAEDGKLPTQI
KTPDIVKKHYQLGIKFGVTGTPNMVTSEGELIGGYVEPKELAKMLSE
Download sequence
Identical sequences A0A0B5BVJ2 A0A248ZZ96 E2P7E3 M9X0Y2 S9ZDQ8
WP_006249160.1.100578 WP_006249160.1.101281 WP_006249160.1.14651 WP_006249160.1.15850 WP_006249160.1.18032 WP_006249160.1.19836 WP_006249160.1.20456 WP_006249160.1.2132 WP_006249160.1.21690 WP_006249160.1.22107 WP_006249160.1.23336 WP_006249160.1.24300 WP_006249160.1.25136 WP_006249160.1.26880 WP_006249160.1.27302 WP_006249160.1.2785 WP_006249160.1.28573 WP_006249160.1.29735 WP_006249160.1.30596 WP_006249160.1.33793 WP_006249160.1.34159 WP_006249160.1.34894 WP_006249160.1.39283 WP_006249160.1.40079 WP_006249160.1.41844 WP_006249160.1.42410 WP_006249160.1.42606 WP_006249160.1.43708 WP_006249160.1.44810 WP_006249160.1.45083 WP_006249160.1.47009 WP_006249160.1.49314 WP_006249160.1.49495 WP_006249160.1.50719 WP_006249160.1.52776 WP_006249160.1.55804 WP_006249160.1.61638 WP_006249160.1.62250 WP_006249160.1.63192 WP_006249160.1.63974 WP_006249160.1.72771 WP_006249160.1.73398 WP_006249160.1.73782 WP_006249160.1.73864 WP_006249160.1.74727 WP_006249160.1.74925 WP_006249160.1.76946 WP_006249160.1.78880 WP_006249160.1.8019 WP_006249160.1.802 WP_006249160.1.81289 WP_006249160.1.82341 WP_006249160.1.84529 WP_006249160.1.8479 WP_006249160.1.90102 WP_006249160.1.91740 WP_006249160.1.93146 WP_006249160.1.94296 WP_006249160.1.95739 WP_006249160.1.9701 gi|525656003|ref|YP_008219365.1| gi|526468460|ref|YP_008338608.1| gi|472333833|ref|YP_007666108.1| gi|472336717|ref|YP_007668991.1| gi|525662737|ref|YP_008221615.1| gi|482886464|ref|YP_007883637.1| gi|525701665|ref|YP_008233350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]