SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656171|ref|YP_008219553.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656171|ref|YP_008219553.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000453
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 79-194
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000102
Family Glutathione S-transferase (GST), C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525656171|ref|YP_008219553.1|
Sequence length 206
Comment UreX protein [Mannheimia haemolytica D171]
Sequence
MKLWYSTTSPFARKALAVIKHHQLDDKVEMLRVTKAMDPNSPHNQDNPLGRIPALQRNCG
RWLFGSLLISEYLDQKGNNTPLLPKEGKPRWAVLALHNLADGIMENTMPTLLQERMARPE
NEWWVSRHEQLMERNIRSFRQLEEALQEFGTELNLGTLTAVALIDWWAFRLDKIGYDLAK
NYPNLTAWAEEMNNKYAILAETKPSM
Download sequence
Identical sequences A0A0B5BVL2 A0A248ZYC1 M9X494
gi|525663149|ref|YP_008222107.1| gi|482887113|ref|YP_007884286.1| WP_006248039.1.100578 WP_006248039.1.101281 WP_006248039.1.14651 WP_006248039.1.15850 WP_006248039.1.18032 WP_006248039.1.19836 WP_006248039.1.20456 WP_006248039.1.2132 WP_006248039.1.21690 WP_006248039.1.22107 WP_006248039.1.23336 WP_006248039.1.24300 WP_006248039.1.25136 WP_006248039.1.26880 WP_006248039.1.27302 WP_006248039.1.2785 WP_006248039.1.28573 WP_006248039.1.29735 WP_006248039.1.30596 WP_006248039.1.33793 WP_006248039.1.34159 WP_006248039.1.34894 WP_006248039.1.40079 WP_006248039.1.41844 WP_006248039.1.42410 WP_006248039.1.42606 WP_006248039.1.43708 WP_006248039.1.44810 WP_006248039.1.45083 WP_006248039.1.47009 WP_006248039.1.49314 WP_006248039.1.49495 WP_006248039.1.50719 WP_006248039.1.52776 WP_006248039.1.55804 WP_006248039.1.61638 WP_006248039.1.62250 WP_006248039.1.63192 WP_006248039.1.63974 WP_006248039.1.72771 WP_006248039.1.73398 WP_006248039.1.73782 WP_006248039.1.73864 WP_006248039.1.74727 WP_006248039.1.74925 WP_006248039.1.76946 WP_006248039.1.78880 WP_006248039.1.8019 WP_006248039.1.802 WP_006248039.1.81289 WP_006248039.1.82341 WP_006248039.1.84529 WP_006248039.1.8479 WP_006248039.1.90102 WP_006248039.1.91740 WP_006248039.1.93146 WP_006248039.1.94296 WP_006248039.1.95684 WP_006248039.1.95739 gi|525701820|ref|YP_008233531.1| gi|472336850|ref|YP_007669124.1| gi|472333474|ref|YP_007665749.1| gi|525656171|ref|YP_008219553.1| gi|526469075|ref|YP_008339297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]