SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656349|ref|YP_008219734.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656349|ref|YP_008219734.1|
Domain Number 1 Region: 24-137
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 8.63e-37
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.0000584
Further Details:      
 
Domain Number 2 Region: 476-586
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.39e-26
Family Thioltransferase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525656349|ref|YP_008219734.1|
Sequence length 587
Comment thiol:disulfide interchange protein [Mannheimia haemolytica D171]
Sequence
MIRYFFSLVLSLLMINSSHANLFSQPKFLKSEEAFVFSIQNENETLQLNWDIADNYYLYK
KEIRVTPQNIEIGDITFPAAEQYNDEFFGQVEIYRNHLGLKVPFKEIKDNASIAVEYQGC
TKGFCYPPERVELKLDSILSATPEELAQLEAQAVEKSENFAKTDNMAPPENVAKAEQDQL
AENLANNRFSIFWFFVLGVGLAFTPCVLPMLPLLSAIVIGNKQRPSTAKALLLSIAYVQG
MAVTYTLLGLIVAAIGLPFQIALQSPPVLIGLSIVFILLACSMFGLYEIQLPNSWQQKLN
AMSQKQQGGALGSVFLMGMIAGLIASPCTSAPLSGALLYVAQSGDLVTGGLALYLLALGM
GLPLILITLFGNKILPKSGEWLLKVKAAFGFVMLALPVFLLSRVLPSHYEPFLWSALAVA
FLIWLVDAIPSNSITKKIIKVLLLLALAIAAKPWADLAWNGSTTQQQTTPHLALEKIQSL
ADLETKLTASKGKKVMLDLYADWCVACKEFEKYTFSDQNVQNKLNEMVVLQIDMTKNSAE
NIELMKHFNVLGLPTILFFDENGNEMSQSRVTGFLDAEQFLAWLNKL
Download sequence
Identical sequences WP_020824179.1.26880 WP_020824179.1.30596 WP_020824179.1.40079 WP_020824179.1.49314 WP_020824179.1.49495 WP_020824179.1.63192 WP_020824179.1.9701 gi|525656349|ref|YP_008219734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]