SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656383|ref|YP_008219768.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656383|ref|YP_008219768.1|
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.87e-21
Family Thioltransferase 0.0093
Further Details:      
 
Domain Number 2 Region: 109-244
Classification Level Classification E-value
Superfamily TPR-like 0.0000107
Family Tetratricopeptide repeat (TPR) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525656383|ref|YP_008219768.1|
Sequence length 281
Comment hypothetical protein J450_03575 [Mannheimia haemolytica D171]
Sequence
MDYFVNVNEQNFSEVWAAAAQVPTVFHFISPREVASLEMDALLRRISDENPNQFLLATVN
CDEQQALAAQFRIQQIPTLYLFAGGQPIDAIQGAVSEQELRIRLANILPKEEELKFQQAL
ELLQDQRYTEALPLLKSAWEMTDKKNSDFALLYAETYIAMKSVEEAREILKAIPIQDRDS
RWHGLQAQIELLEQASESPELQQLQADYANSKTPEIAIKLANQLHQAHKNEEALTLLFDW
LKSDLNVANGEVKSQFLAILSALGTDPIVPKFRRQLYSLLY
Download sequence
Identical sequences A0A0B5BQE6 A0A248ZZ15 E2P9A2 M9X4X4 S9ZLU2
gi|525702067|ref|YP_008233785.1| gi|472337155|ref|YP_007669429.1| WP_006247986.1.100578 WP_006247986.1.101281 WP_006247986.1.14651 WP_006247986.1.15850 WP_006247986.1.18032 WP_006247986.1.19836 WP_006247986.1.20456 WP_006247986.1.2132 WP_006247986.1.21690 WP_006247986.1.22107 WP_006247986.1.23336 WP_006247986.1.24300 WP_006247986.1.25136 WP_006247986.1.26880 WP_006247986.1.27302 WP_006247986.1.2785 WP_006247986.1.28573 WP_006247986.1.29735 WP_006247986.1.30596 WP_006247986.1.33793 WP_006247986.1.34159 WP_006247986.1.34894 WP_006247986.1.39283 WP_006247986.1.40079 WP_006247986.1.41844 WP_006247986.1.42410 WP_006247986.1.42606 WP_006247986.1.43708 WP_006247986.1.44810 WP_006247986.1.45083 WP_006247986.1.47009 WP_006247986.1.49314 WP_006247986.1.49495 WP_006247986.1.50719 WP_006247986.1.52776 WP_006247986.1.55804 WP_006247986.1.61638 WP_006247986.1.62250 WP_006247986.1.63192 WP_006247986.1.63974 WP_006247986.1.72771 WP_006247986.1.73398 WP_006247986.1.73782 WP_006247986.1.73864 WP_006247986.1.74727 WP_006247986.1.74925 WP_006247986.1.76946 WP_006247986.1.78880 WP_006247986.1.8019 WP_006247986.1.802 WP_006247986.1.81289 WP_006247986.1.82341 WP_006247986.1.84529 WP_006247986.1.8479 WP_006247986.1.90102 WP_006247986.1.91740 WP_006247986.1.93146 WP_006247986.1.94296 WP_006247986.1.95684 WP_006247986.1.95739 WP_006247986.1.9701 gi|482887383|ref|YP_007884556.1| gi|472333202|ref|YP_007665477.1| gi|526469338|ref|YP_008339567.1| gi|525656383|ref|YP_008219768.1| gi|525663384|ref|YP_008222348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]