SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656933|ref|YP_008220357.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656933|ref|YP_008220357.1|
Domain Number 1 Region: 49-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.23e-25
Family Glutathione peroxidase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525656933|ref|YP_008220357.1|
Sequence length 171
Comment thioredoxin [Mannheimia haemolytica D171]
Sequence
MQKKSLISRLLKNIFLYGSLFIIISLVVDWYRSPSAPAQFEQTVHYDIQHQPKVIAQLSH
EKPMLLYFWGSWCHYCQVVSPNIQQLANDGTEVLGVALKSGDENDVQAYLNENGYTFATL
NDPSGDFSRGWNIQATPTILIIKDGKIAHHTTGYTSYLSLKFRLWLADVLY
Download sequence
Identical sequences A0A0B5BP39 A0A248ZXU1 E2PAP7 M9X386 S9ZRR0
gi|525656933|ref|YP_008220357.1| gi|525663904|ref|YP_008222890.1| gi|482885166|ref|YP_007882339.1| gi|472332606|ref|YP_007664881.1| gi|526469894|ref|YP_008340145.1| gi|472337751|ref|YP_007670025.1| WP_006248251.1.100578 WP_006248251.1.101281 WP_006248251.1.14651 WP_006248251.1.15850 WP_006248251.1.18032 WP_006248251.1.19836 WP_006248251.1.20456 WP_006248251.1.2132 WP_006248251.1.21690 WP_006248251.1.22107 WP_006248251.1.23336 WP_006248251.1.24300 WP_006248251.1.25136 WP_006248251.1.26880 WP_006248251.1.27302 WP_006248251.1.2785 WP_006248251.1.28573 WP_006248251.1.29735 WP_006248251.1.30596 WP_006248251.1.33793 WP_006248251.1.34159 WP_006248251.1.34894 WP_006248251.1.39283 WP_006248251.1.40079 WP_006248251.1.41844 WP_006248251.1.42410 WP_006248251.1.42606 WP_006248251.1.43708 WP_006248251.1.44810 WP_006248251.1.45083 WP_006248251.1.47009 WP_006248251.1.49314 WP_006248251.1.49495 WP_006248251.1.50719 WP_006248251.1.52776 WP_006248251.1.55804 WP_006248251.1.61638 WP_006248251.1.62250 WP_006248251.1.63974 WP_006248251.1.72771 WP_006248251.1.73398 WP_006248251.1.73782 WP_006248251.1.73864 WP_006248251.1.74727 WP_006248251.1.74925 WP_006248251.1.76946 WP_006248251.1.78880 WP_006248251.1.8019 WP_006248251.1.802 WP_006248251.1.81289 WP_006248251.1.82341 WP_006248251.1.84529 WP_006248251.1.8479 WP_006248251.1.90102 WP_006248251.1.91740 WP_006248251.1.93146 WP_006248251.1.94296 WP_006248251.1.95684 WP_006248251.1.95739 WP_006248251.1.9701 gi|525702739|ref|YP_008234483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]