SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656118|ref|YP_008219500.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656118|ref|YP_008219500.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-41
Family Thioltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525656118|ref|YP_008219500.1|
Sequence length 208
Comment DSBA oxidoreductase [Mannheimia haemolytica D171]
Sequence
MKIEVWSDYACPFCYIGKRHLEQALAQFEGEVEVVFRAFELDPHANGEPEGDIQQRLMRK
YQKTAEQADEMIRYVEQAGKQAGLDLRYRTTQYTRTFEAHRLAKFAKSKGLGEVMIERLF
KAYFSDNLILAKRTQLIDLALELGLDRDEVAQLLTGDDFGHEVREDERMAHRYGINSVPF
FVIDEKLGVSGAQPPKVLLDAIKQALQK
Download sequence
Identical sequences gi|525656118|ref|YP_008219500.1| WP_006250645.1.20456 WP_006250645.1.2132 WP_006250645.1.23336 WP_006250645.1.26880 WP_006250645.1.30596 WP_006250645.1.41844 WP_006250645.1.44810 WP_006250645.1.49314 WP_006250645.1.49495 WP_006250645.1.72771 WP_006250645.1.8479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]