SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525656962|ref|YP_008220386.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525656962|ref|YP_008220386.1|
Domain Number 1 Region: 29-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-18
Family Glutathione peroxidase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525656962|ref|YP_008220386.1|
Sequence length 161
Comment hypothetical protein J450_06860 [Mannheimia haemolytica D171]
Sequence
MMKKIISLLIMMLSLNSYAQENSHLGHIPLKDLNQNQITLDKYQGKKIYIKAWASWCSIC
LAGLAEIEEISQKANNDIEIITIVSPGHKGEKTTNQFIEWYKGIESDYPNITVLLDEQGD
FIKQTEIRGYPHNLLLDSSLNLKKSIPGHLNSEQILHSITN
Download sequence
Identical sequences S9Y219
gi|525656962|ref|YP_008220386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]