SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525657157|ref|YP_008220582.1| from Mannheimia haemolytica D171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525657157|ref|YP_008220582.1|
Domain Number 1 Region: 45-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-34
Family Glutathione peroxidase-like 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525657157|ref|YP_008220582.1|
Sequence length 179
Comment thiol:disulfide interchange protein [Mannheimia haemolytica D171]
Sequence
MNKKFLLPLILFLALSVAFLVQLARNSQGDDPKKLESALIGKTVPSFNLESVLDEKQTID
QSIVKTGKPRLLNVWATWCPTCYAEHEYLTILAKQGVEIVGIDYKDERPKAIKFLANYGN
PYKAIIFDPKGSLGLDLGVYGAPETFIIDGNGVIQYRHAGDVNDQVWNQVLKPIYEKLK
Download sequence
Identical sequences E2P5A6
gi|525657157|ref|YP_008220582.1| WP_006250783.1.20456 WP_006250783.1.2132 WP_006250783.1.23336 WP_006250783.1.26880 WP_006250783.1.30596 WP_006250783.1.41844 WP_006250783.1.44810 WP_006250783.1.49314 WP_006250783.1.49495 WP_006250783.1.72771 WP_006250783.1.8479 WP_006250783.1.9701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]