SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_002270 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_002270
Domain Number 1 Region: 262-407
Classification Level Classification E-value
Superfamily Flavoproteins 3.01e-36
Family Flavodoxin-related 0.0052
Further Details:      
 
Domain Number 2 Region: 11-297
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.86e-36
Family ROO N-terminal domain-like 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_002270
Sequence length 411
Comment | organism=Entamoeba_dispar_SAW760 | product=nitric oxide reductase, putative | location=DS549550:12191-13426(-) | length=411
Sequence
MQNLAVKVADNLYWVGAIDFDLRTFDIIVPTPFGTTYNSFLLTTNDGNVLFETVKEPFHQ
EHLERIENVIGKKGQINYIILNHTEPDHSGSLNYILEKHPNATVIATAAALNNLKFISHL
STTVKTACSIKLKSLQVGKYHLKFLIQPFLHWPDTMMTVIEELKVLLPCDFFAVHYAEPK
LFDDQVEGKEQVLEKLYKHYFDAVMSPFKASVLKGVQLVETQMGFPVEELQAICCSHGLI
IRKDIKKIIEKYKEWSEPQILKNKIVVVYASAYGYTKIMTNRIVEGIRSVGVEVSVYNII
DTTVKEILNDFKDAKGLLLGSPTIVGDATPPFYELLGHMNPFIYSNRLIQCFGSFGWSGE
GVKNLIPRIQQLKVKEVNKPLSIRFRPTKEQETECFNWGKDFGTKVIDYHH
Download sequence
Identical sequences B0EJ76
jCVI|EDI_002270 XP_001738262.1.18373 gi|165898551|gb|EDR25384.1| gi|167387690|ref|XP_001738262.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]