SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_074370 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_074370
Domain Number 1 Region: 78-209
Classification Level Classification E-value
Superfamily ARM repeat 0.0000782
Family MIF4G domain-like 0.056
Further Details:      
 
Weak hits

Sequence:  jCVI|EDI_074370
Domain Number - Region: 14-48
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00314
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_074370
Sequence length 255
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein | location=DS549196:28881-29648(+) | length=255
Sequence
MEEVVSNDRIIQEFKNMRKEMNELKQRIEIIEEENNVLRKENEYLGLLITTQMNEQTINY
TKRLWGDNISYDINQEEGTFVQILQTILEESNNDAIDMYVICQLKNALLETRMDTRISLN
TLENVGRLLKQCENEDYSLVLKCLKAIIISNPNLIGFCVDYLCDNFEKNIIIDKMTILEA
FYSCVLNNQTEVVHSKIIHSILPLFKDIEKGIFPNEYVDLYFTIIKHSYSTFDSLKELIK
SIISSSTNDLVNFLN
Download sequence
Identical sequences B0EGC7
XP_001737305.1.18373 gi|165899950|gb|EDR26429.1| gi|167385338|ref|XP_001737305.1| jCVI|EDI_074370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]