SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_092690 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_092690
Domain Number 1 Region: 98-382
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.44e-41
Family ROO N-terminal domain-like 0.0000482
Further Details:      
 
Domain Number 2 Region: 348-492
Classification Level Classification E-value
Superfamily Flavoproteins 3.67e-37
Family Flavodoxin-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_092690
Sequence length 495
Comment | organism=Entamoeba_dispar_SAW760 | product=type A flavoprotein fprA, putative | location=DS548800:129545-131247(+) | length=495
Sequence
MQRRNINRTLILFYIFSRQQNKTLVSIIKLLKVTFSEFNQEKRKKGRGTNRKKKDVEEKK
EEKEEKKRSGQKRKENIKRGTKRKKTIRMKGLEVVKDLYWVGVFDKELRVFDIIMRTPYG
TTYNSFLLKSEKGNVLFETCKENFAEECLERIEDVIGKEGKIDYIVLNHTEPDHSGSLVH
ILEKYPEATVIGTMAALNNIKYIGHIKENTKTLNSGKIKTLDLGNYHLKFLIQPFLHWPD
TMMTVIEELKVLVSCDVFGGHYADERVFNDQMMDRIKDMDDAYKHYFDCIFGPFKNYVIK
GINMIETQMGFPTDELKAICCSHGPVLRTNIKENIERYRKWAQPIILKNKVVIAYGSAYG
YTQKMAEKISEGIKSSGVDVKIFNIVQSSIDDVLKEFDDAKGLLLGTPTLVNDAIPPIMN
IACSLNPTIHCNRFIQCFGSFGWSGEGVKNLSARIIQLKAHQPVEPLSIKFHPNSIELQT
CFDWGKKFADALLNA
Download sequence
Identical sequences B0ED61
gi|165901395|gb|EDR27478.1| gi|167382710|ref|XP_001736230.1| XP_001736230.1.18373 jCVI|EDI_092690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]