SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_092880 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_092880
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.86e-42
Family ROO N-terminal domain-like 0.0000482
Further Details:      
 
Domain Number 2 Region: 260-404
Classification Level Classification E-value
Superfamily Flavoproteins 2.49e-37
Family Flavodoxin-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_092880
Sequence length 407
Comment | organism=Entamoeba_dispar_SAW760 | product=type A flavoprotein fprA, putative | location=DS548800:162288-163511(-) | length=407
Sequence
MKGLEVVKDLYWVGVFDKELRVFDIIMRTPYGTTYNSFLLKSEKGNVLFETCKENFAEEC
LERIEDVIGKEGKIDYIVLNHTEPDHSGSLVHILEKYPEATVIGTMAALNNIKYIGHIKE
NTKTLNSGKIKTLDLGNYHLKFLIQPFLHWPDTMMTVIEELKVLVSCDVFGGHYADERVF
NDQMMDRIKDMDDAYKHYFDCIFGPFKNYVIKGINMIETQMGFPTDELKAICCSHGPVLR
TNIKENIERYRKWAQPIILKNKVVIAYGSAYGYTQKMAEKISEGIKSSGVDVKIFNIVQS
SIDDVLKEFDDAKGLLLGTPTLVNDAIPPIMNIACSLNPTIHCNRFIQCFGSFGWSGEGV
KNLSARIIQLKAHQPVEPLSIKFHPNSIELQTCFDWGKKFADALLNA
Download sequence
Identical sequences B0ED80
jCVI|EDI_092880 XP_001736248.1.18373 gi|165901414|gb|EDR27497.1| gi|167382748|ref|XP_001736248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]