SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_190610 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EDI_190610
Domain Number - Region: 11-160
Classification Level Classification E-value
Superfamily ARM repeat 0.00864
Family Armadillo repeat 0.065
Further Details:      
 
Domain Number - Region: 183-272
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0327
Family Tricorn protease domain 2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_190610
Sequence length 289
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein | location=DS547850:30036-30905(+) | length=289
Sequence
MSCSSFQLLCEHTQILQQNILKVINPNKYSPIEAIQLEIVSIISSIVDYLNNQKQTIEEI
IKKVCECSQPLKETIKLEPCQELSLIIEKPKDGISEFELPGPLPLPKEFNTLNDNFGELT
PYYSHLKEWCRKSEAHIIFESKDLTSKTFWHLTKNLKNMMIIIQTEDNYMFGSYHSILPK
SQDVWVQNDPNHFVFTLTNPNHVKPCRFDPLPTNNNLLFIYGDNDIENVVWINYCYWITC
DNIIYLWHHFPDNYIDTTGFGGDLFVGCVDWDNPNEIKKVYILEWINKE
Download sequence
Identical sequences B0E629
gi|165904869|gb|EDR30002.1| gi|167376082|ref|XP_001733850.1| jCVI|EDI_190610 XP_001733850.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]