SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_229060 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_229060
Domain Number 1 Region: 223-442
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000307
Family Plakophilin 1 helical region 0.08
Further Details:      
 
Weak hits

Sequence:  jCVI|EDI_229060
Domain Number - Region: 769-940
Classification Level Classification E-value
Superfamily ARM repeat 0.00307
Family PBS lyase HEAT-like repeat 0.068
Further Details:      
 
Domain Number - Region: 17-96
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0447
Family Inorganic pyrophosphatase 0.0043
Further Details:      
 
Domain Number - Region: 552-818
Classification Level Classification E-value
Superfamily ARM repeat 0.0783
Family MIF4G domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_229060
Sequence length 962
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein | location=DS549908:40152-43040(+) | length=962
Sequence
MQQTCCRSESSDTLDLFHLTEWTTKLNEIYNNTINIPSEQQDQKIEIEKIVNLVCIDGVL
HIPYGIIKSGIISEAQPNDNIYICGTIKTLTSIINTIVMNKHITLNGCSVYDINEMIYGI
MAMGINNNEFINEFGKWLIDHKSERLDDIAETYLINSLLSHNKEIAYQLRDQLGLAENTQ
KVFSSMVLEEGISDISCSQESMGVIIGFVIENIIREGGEWYSELQKLLNKSITNREYIQP
LIIGCWRLCNEDKCQKEFIESGCLKEVIEIIKSSTKEDIILIFIEITILLMQNESNFKSL
EKFEVIKILIEIIKKNLSLKLMEMSGLRALSLYCGFEENNNKMIDNQWIEVIKNVMELYL
SDEGIQSIGLNIFIKILSTKRCISRFIEIGVIDNVIQIFQIYKDSPGILLLCFQVYKEIV
KNIKDTKILNIFPLIIQISHSFENDISIISGCMFIFSYIFSLSNTINFKTDDNIKWIFEL
AMKFIELEDIQNAVIQIVFSLINDKQINICKLNNCIIIVSFLVLQSTTIDQSIKIMKIIH
YFLSNGVSNELLGQDIFNIITERMKKSDNEEVIVHSIQCLEDGINEDFSMNEKQIKKYEN
WVNICVNKCHTFNTPKINKKCLSLIKKYIEGYRSIDKLEDQEWRDIIFNNISQNQENIEI
IKDALTLRVIANQIQPFFSYNEVIQIIQILETVIQKISNKEFDQLVLQICILFLCPFNQN
VIQISQLLKKSILYKRIIQQIPSISNQLNVSVLQVLMTSLLLSNSYSIYSFISLNVWEVV
SSLSNDPEISQLLNTTTSMNSFCNLIKQLPNSQTNCIGFYAIMSVTTLSSQDQQLMIQYA
IQLLSTPSTSISERRNAILLFALLNNDSIKREESLIKKSLTSIINVLSEPHCPTDYVCVG
VCALFNLAIIPSIRTLINTPNTKTILNNLIEENEDCKEIITKILKRVNEEGNHKGFSSQI
DI
Download sequence
Identical sequences B0ELT5
XP_001739118.1.18373 jCVI|EDI_229060 gi|165897337|gb|EDR24528.1| gi|167389866|ref|XP_001739118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]