SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_325140 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_325140
Domain Number 1 Region: 4-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 8.4e-36
Family ROO N-terminal domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 262-407
Classification Level Classification E-value
Superfamily Flavoproteins 1.77e-35
Family Flavodoxin-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_325140
Sequence length 413
Comment | organism=Entamoeba_dispar_SAW760 | product=hypothetical protein, conserved | location=DS548606:25154-26395(+) | length=413
Sequence
MTSKVLEVLPGLYWVGVMDYELKKYDVLYPAPYGSTYNSYLLKTQKGNVLFETVKQEFAN
ECLDKIEQVIGKEDRIDYIIVDHSEPDHSGSLSPILKRYPNATVVASTAALNNLQFIGHI
RDDIKTINTVKTKQLNLGDIHLKFIYQPFLHWPDTMITLIEEMNVLVTCDMFSTHFADER
MFDDLIIDRKDQYLQISYDYFNSVFGPFKRFVLKGIQMLEHQPGFDLKNCKAICCSHGPI
LRGYIRERVDLWRQWAQPPSLKNKVVIAYGSVYGYTETMANTIASGIKSVGIEVSMHNIE
NTSSEEVLKDFDNCKGLLLGTPTIVGDALPSILTIACNLNPYLHCQRFIQCFGSHGWSGE
GVGNLSARLRQLKAKQPVEPLSCRLQPGQEKLEECFEWGKKFGLAIKEEDEEN
Download sequence
Identical sequences B0EBM5
jCVI|EDI_325140 XP_001735719.1.18373 gi|165902148|gb|EDR28037.1| gi|167381444|ref|XP_001735719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]