SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_336340 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_336340
Domain Number 1 Region: 11-296
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.58e-40
Family ROO N-terminal domain-like 0.0000616
Further Details:      
 
Domain Number 2 Region: 263-410
Classification Level Classification E-value
Superfamily Flavoproteins 2.03e-36
Family Flavodoxin-related 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_336340
Sequence length 415
Comment | organism=Entamoeba_dispar_SAW760 | product=type A flavoprotein fprA, putative | location=DS550549:49856-51103(+) | length=415
Sequence
MTLKALKVCENLYWVGALDNDLRVFDIIMSTPYGTSYNSFLLTTSEGNILFETVKENFAQ
ECLSRVADVIGESGKIDYIVCNHTEPDHSGSLVHILEKFPQATVIATFAALTNIKYIGHI
TKKTKTIDSTKNKQFKLGQYTLNFFIQPFLHWPDTMMTVIPELKVLLPCDVFGAHCADPR
VFNDEMMDRIKDLEDAYKHYFDCIFGPYTSFVLKGINILENNIGFPVDELKAICCSHGPV
LRTNIKENIERYKNWSQPKVLKDRVIIAYGSAYGYTEMMAEKIAEGVKSVGVEVIMHNIV
TSSVDAILKDFENSKGLLLGTPTLVGEALPQMYIILAHLNPIIHCSRYVQCFGTYGWSCE
GVRNLSVRIDQLMVRRPVQPLSFRFKPTEENLKECFEWGKTFATALLQNKEFVSE
Download sequence
Identical sequences B0ERU0
gi|165894903|gb|EDR22735.1| gi|167394028|ref|XP_001740812.1| XP_001740812.1.18373 jCVI|EDI_336340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]