SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_348910 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_348910
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-73
Family Inorganic pyrophosphatase 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_348910
Sequence length 244
Comment | organism=Entamoeba_dispar_SAW760 | product=soluble inorganic pyrophosphatase 1, chloroplast precursor, putative | location=DS547905:55363-56097(-) | length=244
Sequence
MSITSIVPNFGTVRTESVGTLGKKDYRIYFEQEGKKISPWHKIPAFVSKEVVNMVCEIPR
GTNAKMEISTTTKFNPIKQDLNKDGSLRYMKHGNVLNHYGAVPQTWEDLFERDSIVGIPG
DNDPIDIIDISQKKVARGEIIQVKPICALALLDGGETDWKVIGINVNDPLAQTIKSANDI
EKTVDEIREWYRVYKVAEGKKLNKYAYGGKAFNQKSTLDIMNETHLQYRKLKTTQKKLSK
LALD
Download sequence
Identical sequences B0E6I6
gi|165904693|gb|EDR29881.1| gi|167376454|ref|XP_001734004.1| XP_001734004.1.18373 jCVI|EDI_348910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]