SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392401662|ref|YP_006438274.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392401662|ref|YP_006438274.1|
Domain Number 1 Region: 134-213
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000636
Family Intron-encoded homing endonucleases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392401662|ref|YP_006438274.1|
Sequence length 251
Comment hypothetical protein Turpa_0106 [Turneriella parva DSM 21527]
Sequence
MRIRPAGRTAKAKSASGKNRRRSARRNRSDRSPYTARPSLQKVNIDIIAAFLRRFPLKFS
TARLTLLEIADKVLEKKVQMPRPAKLKAHMVFEMLTRSGGRARAGVTGACSEWRGAFKGG
YPVVTTVNSQRGHRLNVDARKYILENPARGRRRNFRTIPQNLCGNVKCVNPRHIRMVPIN
PDSHQGENHPRSKFTDKDVVRMVKEYNAGSTAREIAKKYDIQLTYVEQIMRKEKRTEATE
GLKIRGRFGFR
Download sequence
Identical sequences I4B0G1
WP_014801289.1.12531 gi|392401662|ref|YP_006438274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]