SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392402117|ref|YP_006438729.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392402117|ref|YP_006438729.1|
Domain Number 1 Region: 133-185
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000001
Family Intron-encoded homing endonucleases 0.013
Further Details:      
 
Weak hits

Sequence:  gi|392402117|ref|YP_006438729.1|
Domain Number - Region: 41-70
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00392
Family CRAL/TRIO domain 0.012
Further Details:      
 
Domain Number - Region: 69-110
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00883
Family Intron-encoded homing endonucleases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392402117|ref|YP_006438729.1|
Sequence length 205
Comment hypothetical protein Turpa_0571 [Turneriella parva DSM 21527]
Sequence
MNSMTIRKAPALSEGKQTATARTLAEDGIKRLIGIFAEKDENGCIFWHGEFDKDQRPIIL
ERNKKVNVRSRIFRLRNPGQEGKKIFNTCGNKKCIAPEHASVNRRARACDEKLGQYIVTD
TGCYVFPHKIALNTQPKVRVKGNVISASRAAYIQANGEIPVGWHIKHTCGTPACINPRHL
RAEAPRTERLFREPRNLSAKRETAA
Download sequence
Identical sequences I4B1R6
gi|392402117|ref|YP_006438729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]