SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392402118|ref|YP_006438730.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392402118|ref|YP_006438730.1|
Domain Number 1 Region: 97-173
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000000235
Family Intron-encoded homing endonucleases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392402118|ref|YP_006438730.1|
Sequence length 315
Comment hypothetical protein Turpa_0572 [Turneriella parva DSM 21527]
Sequence
MSSQKHNEIKERILAKCVRDVAGCLVWQGSIHGKDGTPILKVSGIKKQIRVRPFLMDTVL
KSRPKRVKGCAMNALCIDPEHCARASERKTMREKLGNYRIIAETGCHVLKGRNNLAGYCQ
ILHETRYLLAHREAYRLFKSEIETGKEVHHTCNTPACINPEHLVLVTPAENKLMAQRDGL
LNGPRIRGEGHGNTRLKVIEIALIREMAANGISTKEIQKKYKLSRAQVRHIVRGLKHNNI
TLVARIYGESTYQGFRHTLNMIAENRADRSETVAVLDNGRIRHYYNDRRDECWLEIDFSL
LSPWSRKILGIPNAA
Download sequence
Identical sequences I4B1R7
WP_014801743.1.12531 gi|392402118|ref|YP_006438730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]