SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392402670|ref|YP_006439282.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392402670|ref|YP_006439282.1|
Domain Number 1 Region: 25-241
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.77e-58
Family Endonuclease I 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392402670|ref|YP_006439282.1|
Sequence length 247
Comment Endonuclease I [Turneriella parva DSM 21527]
Sequence
MHIRWLRAATLGFLVTCIWPDGNISIANFRKAKQLVYQIAAPENRTFYCNCAFSAEGIDR
ASCGYVPLNDNARANRTEIEHIVPAENFGKSFAEWRDGHADCVRTNGTRYKGRRCAGKAS
ATYRLMEADLYNLVPEIGELNADRRNYRFGIIEGEARNYGACDFEVEDRVTEPRPEIRGD
IARVYFYMNAAYPGRGIIGNKAQKLFEAWDKADPVDAVECRRAAKIEHVQGNANEFVKQP
CAAAGLY
Download sequence
Identical sequences I4B3B9
gi|392402670|ref|YP_006439282.1| WP_014802293.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]