SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392404664|ref|YP_006441276.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392404664|ref|YP_006441276.1|
Domain Number 1 Region: 69-125
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000589
Family Intron-encoded homing endonucleases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392404664|ref|YP_006441276.1|
Sequence length 144
Comment hypothetical protein Turpa_3131 [Turneriella parva DSM 21527]
Sequence
MALWSRKKSTPAIAVALQLSETQTSTKLPAEIKPIQAQPKKKKTLKRSKLPVPAAVKRRF
EGYLQKGRRCWSWKGSHTTDGYAQFWVNDTKVVKAHRFAYEIYVRQLGKRERLHNLCENK
QCVNPACWAPFAIGARKKLVGRRV
Download sequence
Identical sequences I4B913
gi|392404664|ref|YP_006441276.1| WP_014804270.1.12531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]