SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392405386|ref|YP_006441998.1| from Turneriella parva DSM 21527

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392405386|ref|YP_006441998.1|
Domain Number 1 Region: 869-1022
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-32
Family Histidine kinase 0.00088
Further Details:      
 
Domain Number 2 Region: 530-640
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 
Domain Number 3 Region: 222-333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.93e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 
Domain Number 4 Region: 328-505
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000235
Family GAF domain 0.012
Further Details:      
 
Domain Number 5 Region: 784-868
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000981
Family Homodimeric domain of signal transducing histidine kinase 0.0092
Further Details:      
 
Domain Number 6 Region: 642-768
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000349
Family PYP-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392405386|ref|YP_006441998.1|
Sequence length 1028
Comment multi-sensor signal transduction histidine kinase [Turneriella parva DSM 21527]
Sequence
MTGVNCLLFAGWFLILRWRSQNSVVGMLSWAAGMALHGAGWIIIVLRGNDPQWAWLLPGA
TVMLPGTLLLLDGFYRLLNARPVPRIQWVILINFELLLLYFTYADYRSPVRGIISSAYHT
FVILWMAFVLPGNSEAVSKRMRLGLRAVLSLIGLALALRTIANFLYLSDPHYSTLTDAGI
DLATTILFFATAFMPSFIFLAISNEASERRRISVANRLDDLVASIDGIVWEADARTVTFT
YVSSKAERLLGYPASDWLKPGFWQAHIYKDDQIWAPQFCAERARLLQPHEFEYRFVALDG
RIVWLRDLVTVVAEAGEPRWLRGVMVDITARKKKDEELKQLKLIYELLSHCRKAFGEAAD
AEVLLEQIVNSCTVSDDVLLAWIGEEAADSQEVIVKAAAGKAMAYLDEHKISTDETLPEG
RGPTGRAMREKRSVFVNHLDITSHDIFTPGRLKYGMYSCASVYFIHSNGRPMSLNIYAAP
GNFFSAHMIESFEQLAHEISLALERFAIDRWRTYAEQQIRENQILLDFAIESTVDAVWDF
DPRANTVKFSHHWESMLGYDKGELKHSLVDWEKLIHPQDLQAMNENLQGYLRGDMEAFDM
TLRMRSKRGDYIWVKDRGVVVERDEAGKASRLVGTLKNIDSEVRSREEARRNAILLDEVF
NAAPVGLMVIDRQGNVLRSNPKVIEVAGVQSALGSGVAASGAIFYDENHQPYPEGVLPQV
IANQATEQAFAQTFGVRRAEGKELRWVHAISRFVPAIESAICVTSDITDLVESQRSVRDL
AQVLEQRVKERTLELEEINKELEAFSYSLSHDLKAPLVRAESWLNILQQKLRGAFDQNAE
DILQYVRRELAAMTSMGEAMMQLARVSQSELVITAVDLSQIAEQILNDLRIENPESKIEA
EIQPAMVVYADAALARVLIRNLLENAVKYSRQKPAVQISFFQKEATGSPCYCIRDNGIGF
DMQYADRLFAPFQRLHSEKDYPGHGIGLATAQRIVHRHQGTISAESAVDSGTTISFTLRN
QASEAGAR
Download sequence
Identical sequences I4BB35
gi|392405386|ref|YP_006441998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]