SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jCVI|EDI_186670 from Entamoeba dispar 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EDI_186670
Domain Number 1 Region: 57-197,232-288
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.51e-29
Family Phospholipase D 0.064
Further Details:      
 
Domain Number 2 Region: 293-505
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.97e-21
Family Phospholipase D 0.094
Further Details:      
 
Weak hits

Sequence:  jCVI|EDI_186670
Domain Number - Region: 504-560
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0734
Family SAH/MTA deaminase-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EDI_186670
Sequence length 600
Comment | organism=Entamoeba_dispar_SAW760 | product=phopholipase D, putative | location=DS548573:21309-23111(+) | length=600
Sequence
MRRKDKRDKRREREKRREMKRLMIRMFHKKQDQRIVGKIEEKGRQGVFVREKPVFCVPSN
GNEVKELIDGEETMKEIAERIEEAKESIYITDWRIDPEIILIRRGTHRLKGKTLKEILEK
KGEEGVNIKIIIYSSPIFMDIVKGEEKRNILEEKEKIECYCHKWMMGYSQHEKTIIIDHK
IGFLGGIDLAEGRWDTKEHFIETDNKEKGEEIIKEECYNTMINKEENQEKIRLPWHDIHC
KIEGPAVNDIERNFIEKWNKICKKEERIIKEKEENKIKGTMSVQIVRSNSKEAGGKYKVE
RGCYEGIVRIIERAEDYIYIEEQFFISNYGGKRIWNLISLTIGNKIIEAYKKKKKFKVII
VVPIWSEGELKSNIVKTIMKLFRKTIISGKLSLIERMKKEGIKNIEEYLKILTLYTFGKK
KKEGKEIIIGSPIYVHSKCIIVDDQYVFIGSVNINDRSLIGERDTEIGAIIVDSNKIEIE
INGKIKYVNKFALNLRNRIWSEHLNLEEIEIKKLKNDPIKIIDNIIYPISEKNTIIYEKN
FDFFPSNKYPKFIDCKKHLYPELIGDKKYLKDIKGHFIKFPLGFGKDEKASLGMGNILIE
Download sequence
Identical sequences B0EBA7
gi|165902340|gb|EDR28196.1| gi|167381175|ref|XP_001735606.1| XP_001735606.1.18373 jCVI|EDI_186670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]